DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5895 and CG10747

DIOPT Version :9

Sequence 1:NP_648828.3 Gene:CG5895 / 39752 FlyBaseID:FBgn0036560 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001260618.1 Gene:CG10747 / 35295 FlyBaseID:FBgn0032845 Length:328 Species:Drosophila melanogaster


Alignment Length:326 Identity:77/326 - (23%)
Similarity:128/326 - (39%) Gaps:70/326 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 NWMGQI-KDINRMALKDIFLPGTHASAAVLGSSSKSN-------SI---------LVRDYLVAQQ 190
            :||..: .::..:::.::.:||:| ::...|.:|||.       ||         .||.:...|.
  Fly     5 HWMRDLPSELRDLSIINLAIPGSH-NSMTYGINSKSELSPDAEISIRRWHRFFPCFVRRWSKTQS 68

  Fly   191 LDVWSQLVFGIRYLDLSIGYKNMNTENDADNFWIANENMLITPLLTVLRDVRQFV-KRSGEVVVL 254
            .....||..|:||.||.|..|:       |.|:..: .:....:...|.::|||| ....|||:|
  Fly    69 SGTLDQLELGVRYFDLRIAQKD-------DKFYYCH-GLFAMEIFEPLLEIRQFVDTHPEEVVIL 125

  Fly   255 DFSSF-PIGFYKHPEIYSSLFRLIRQELGDETYRRNVGKDENCANRNFSEILLQKRHLVILFPTQ 318
            |...| .:....|.:::..|.:.....|    |....|..::|   ..:..|..:|.:||::...
  Fly   126 DLQHFYAMTVAHHQKLHKDLIQFFAHRL----YSTVDGSLKDC---TLNRCLEMQRSVVIIYRRC 183

  Fly   319 ELPYPDR--ESNMLCPPWQRFST-----SFMNISQTLDYMRLLFSRKPDSPVRNVGWIFTAVRSM 376
            .:|.|.|  .|.....||...::     ||:..|        |.||:|..     |::...:.:.
  Fly   184 PIPLPLRFWPSYAWPTPWPNKASVKKLQSFLEDS--------LLSRQPQQ-----GYVSQCLITP 235

  Fly   377 EQTLNAHQL-----QTAKERAAVLNPKINKWLKGPW----GYNANVVAMDYFSNTN------IVD 426
            .....|.:|     .|||.....|.|.|.:.:.||:    ....||...|:.|...      :||
  Fly   236 TGRYIAFRLFFTLKSTAKRVDKKLQPWIQEQIPGPFEPKDEPRVNVFLADFVSLKGGQFCDWVVD 300

  Fly   427 L 427
            |
  Fly   301 L 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5895NP_648828.3 PI-PLCXDc_CG14945_like 148..435 CDD:176559 75/321 (23%)
CG10747NP_001260618.1 PI-PLCXD1c 10..302 CDD:176555 75/321 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4306
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13593
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.