DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5895 and PLCXD3

DIOPT Version :9

Sequence 1:NP_648828.3 Gene:CG5895 / 39752 FlyBaseID:FBgn0036560 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001005473.1 Gene:PLCXD3 / 345557 HGNCID:31822 Length:321 Species:Homo sapiens


Alignment Length:358 Identity:81/358 - (22%)
Similarity:139/358 - (38%) Gaps:96/358 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 VASYNG-TELLTVDCLKIQPNWMGQI-KDINRMALKDIFLPGTHAS------------------- 167
            :||..| .||...|       ||..: :.::.:.|.::.:||:|.|                   
Human     1 MASSQGKNELKLAD-------WMATLPESMHSIPLTNLAIPGSHDSFSFYIDEASPVGPEQPETV 58

  Fly   168 ---AAVLGSSSKSNSILVRDYLVAQQLDVWSQLVFGIRYLDLSIGYKNMNTEND---ADNFWIAN 226
               .:|.|:.:|.   |:|.:|..|.::...||..||||.||.|..|..:.:|:   |...:.|.
Human    59 QNFVSVFGTVAKK---LMRKWLATQTMNFTGQLGAGIRYFDLRISTKPRDPDNELYFAHGLFSAK 120

  Fly   227 ENMLITPLLTVLRDVRQFVKRSGEVVVLDFSSFPIGF--YKHPEIYSSLFRLIRQELGDETYRRN 289
            .|..:..:...|.|..:      |||.|||:.| .|.  |.|.::...|..:...::....:.:.
Human   121 VNEGLEEINAFLTDHHK------EVVFLDFNHF-YGMQKYHHEKLVQMLKDIYGNKMCPAIFAQE 178

  Fly   290 VGKDENCANRNFSEILLQKRHLVILF---PTQ-ELPY--PDRESNMLCPPWQRFSTSFMNISQTL 348
            |.          .:.|.:|.:.|::|   |.. |:|:  |   ..|:..||          :.|.
Human   179 VS----------LKYLWEKDYQVLVFYHSPVALEVPFLWP---GQMMPAPW----------ANTT 220

  Fly   349 DYMRLL-FSRKPDSPVRNVGWIF-----------TAVRSMEQTLNAHQLQTAKERAAVLNPKINK 401
            |..:|: |.:...:..|..|..|           |.|:.:...|.    :|..|||.   |.:.:
Human   221 DPEKLIQFLQASITERRKKGSFFISQVVLTPKASTVVKGVASGLR----ETITERAL---PAMMQ 278

  Fly   402 WLK--GPWGYNANVVAMDYFSNTNIVDLAIQVN 432
            |::  .|.....|:|..|:....:.:...|::|
Human   279 WVRTQKPGESGINIVTADFVELGDFISTVIKLN 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5895NP_648828.3 PI-PLCXDc_CG14945_like 148..435 CDD:176559 73/333 (22%)
PLCXD3NP_001005473.1 PI-PLCXD1c 19..311 CDD:176555 72/331 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4306
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13593
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.