DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5895 and Plcxd3

DIOPT Version :9

Sequence 1:NP_648828.3 Gene:CG5895 / 39752 FlyBaseID:FBgn0036560 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001101141.1 Gene:Plcxd3 / 310358 RGDID:1308448 Length:321 Species:Rattus norvegicus


Alignment Length:338 Identity:76/338 - (22%)
Similarity:132/338 - (39%) Gaps:88/338 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 NWMGQI-KDINRMALKDIFLPGTHAS----------------------AAVLGSSSKSNSILVRD 184
            :||..: :.|:.:.|.::.:||:|.|                      .:|.|:.:|.   |:|.
  Rat    14 DWMATLPESIHSIPLTNLAIPGSHDSFSFYIDEASPVGPEQPETVQNFVSVFGTVAKK---LMRK 75

  Fly   185 YLVAQQLDVWSQLVFGIRYLDLSIGYKNMNTEND---ADNFWIANENMLITPLLTVLRDVRQFVK 246
            :|..|.:....||..||||.||.|..|..:.:|:   |...:.|..|..:..:...|.|..:   
  Rat    76 WLATQTMSFTGQLGAGIRYFDLRISTKPRDPDNELYFAHGLFSAKVNEGLEEINAFLTDHHK--- 137

  Fly   247 RSGEVVVLDFSSFPIGF--YKHPEIYSSLFRLIRQELGDETYRRNVGKDENCANRNFSEILLQKR 309
               |||.|||:.| .|.  |.|.::...|..:...::....:.:.|.          .:.|.:|.
  Rat   138 ---EVVFLDFNHF-YGMQKYHHEKLVQMLKDIYGNKMCPAIFAQEVS----------LKYLWEKS 188

  Fly   310 HLVILF---PTQ-ELPY--PDRESNMLCPPWQRFSTSFMNISQTLDYMRLL-FSRKPDSPVRNVG 367
            :.|::|   |.. |:|:  |   ..|:..||          :.|.|..:|: |.:...:..|..|
  Rat   189 YQVLVFYHSPVALEVPFLWP---GQMMPAPW----------ANTTDPEKLIQFLQASITERRKKG 240

  Fly   368 WIF-----------TAVRSMEQTLNAHQLQTAKERAAVLNPKINKWLK--GPWGYNANVVAMDYF 419
            ..|           |.|:.:...|.    :|..|||.   |.:.:|::  .|.....|:|..|:.
  Rat   241 SFFISQVVLTPKASTVVKGVASGLR----ETITERAL---PAMMQWIRTQKPGESGINIVTADFV 298

  Fly   420 SNTNIVDLAIQVN 432
            ...:.:...|::|
  Rat   299 ELGDFISTVIKLN 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5895NP_648828.3 PI-PLCXDc_CG14945_like 148..435 CDD:176559 74/333 (22%)
Plcxd3NP_001101141.1 PI-PLCXD1c 19..311 CDD:176555 73/331 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4306
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13593
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.