DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5895 and Plcxd3

DIOPT Version :9

Sequence 1:NP_648828.3 Gene:CG5895 / 39752 FlyBaseID:FBgn0036560 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_796329.2 Gene:Plcxd3 / 239318 MGIID:2442605 Length:321 Species:Mus musculus


Alignment Length:338 Identity:76/338 - (22%)
Similarity:132/338 - (39%) Gaps:88/338 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 NWMGQI-KDINRMALKDIFLPGTHAS----------------------AAVLGSSSKSNSILVRD 184
            :||..: :.|:.:.|.::.:||:|.|                      .:|.|:.:|.   |:|.
Mouse    14 DWMATLPESIHSIPLTNLAIPGSHDSFSFYIDEASPVGPEQPETVQNFVSVFGTVAKK---LMRK 75

  Fly   185 YLVAQQLDVWSQLVFGIRYLDLSIGYKNMNTEND---ADNFWIANENMLITPLLTVLRDVRQFVK 246
            :|..|.:....||..||||.||.|..|..:.:|:   |...:.|..|..:..:...|.|..:   
Mouse    76 WLATQTMSFTGQLGAGIRYFDLRISTKPRDPDNELYFAHGLFSAKVNEGLEEINAFLTDHHK--- 137

  Fly   247 RSGEVVVLDFSSFPIGF--YKHPEIYSSLFRLIRQELGDETYRRNVGKDENCANRNFSEILLQKR 309
               |||.|||:.| .|.  |.|.::...|..:...::....:.:.|.          .:.|.:|.
Mouse   138 ---EVVFLDFNHF-YGMQKYHHEKLVQMLKDIYGNKMCPAIFAQEVS----------LKYLWEKD 188

  Fly   310 HLVILF---PTQ-ELPY--PDRESNMLCPPWQRFSTSFMNISQTLDYMRLL-FSRKPDSPVRNVG 367
            :.|::|   |.. |:|:  |   ..|:..||          :.|.|..:|: |.:...:..|..|
Mouse   189 YQVLVFYHSPVALEVPFLWP---GQMMPAPW----------ANTTDPEKLIQFLQASITERRKKG 240

  Fly   368 WIF-----------TAVRSMEQTLNAHQLQTAKERAAVLNPKINKWLK--GPWGYNANVVAMDYF 419
            ..|           |.|:.:...|.    :|..|||.   |.:.:|::  .|.....|:|..|:.
Mouse   241 SFFISQVVLTPKASTVVKGVASGLR----ETITERAL---PAMMQWIRTQKPGESGINIVTADFV 298

  Fly   420 SNTNIVDLAIQVN 432
            ...:.:...|::|
Mouse   299 ELGDFISTVIKLN 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5895NP_648828.3 PI-PLCXDc_CG14945_like 148..435 CDD:176559 74/333 (22%)
Plcxd3NP_796329.2 PI-PLCXD1c 19..311 CDD:176555 73/331 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4306
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13593
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.