DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5895 and F38E9.1

DIOPT Version :9

Sequence 1:NP_648828.3 Gene:CG5895 / 39752 FlyBaseID:FBgn0036560 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_510673.1 Gene:F38E9.1 / 181712 WormBaseID:WBGene00018184 Length:569 Species:Caenorhabditis elegans


Alignment Length:358 Identity:68/358 - (18%)
Similarity:121/358 - (33%) Gaps:118/358 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 NWMGQI-KDINRMALKDIFLPGTHASAAV-----LGSSSKSNSI-------------LVRDYLVA 188
            :|||:: ..|....|..|.:||:|.|.|.     :|.:...:.:             :|..:.:.
 Worm     3 DWMGRLPSSIREKPLCSICIPGSHDSGAYWFNLRMGYAHDQSFLRYVRNFRCNFVKRIVERWGLT 67

  Fly   189 QQLDVWSQLVFGIRYLDLSI-------GYKNMNTENDAD-----NFWIANENMLITPLLTVLRDV 241
            |.|.:..||..|:|:.|:.:       .....|...|.|     :.:|.:....|..|....:.|
 Worm    68 QSLPIDEQLQIGVRFFDIRLELALDINASARQNLAQDPDDSSRKSCFIVHGLYSIDCLKLAHQMV 132

  Fly   242 RQFVKRSGEVVVL-----------DFSSFPIGFYKHPEIYSSLFRLIRQELG-----DETYRRNV 290
            ...|....||::|           ||..    |:.||      |..|.:..|     .:...|.|
 Worm   133 DFLVAHKEEVLILNVSHIYRMTEYDFRR----FFLHP------FSSIAERCGISLCPTDVDLRIV 187

  Fly   291 GKDENCANRNFSEILLQKR-HLVILFPTQELPYPDRESNMLC-------PPWQRFSTSFMNISQT 347
            ..||          |::|. .::::.|:      |::.:..|       ..|.|.:    |.|..
 Worm   188 TLDE----------LIEKEFRIIVVGPS------DQDMDGCCFRSAALQNKWPRKN----NTSDL 232

  Fly   348 LDYMRLLFSRKPDSPVRNVGWIFT-----AVRSMEQTLNAHQLQTAKERAAVLNPKINKWLK--- 404
            |.|::..........:|.:..:.|     ..|::..:|.       |..:..:...:.:||:   
 Worm   233 LVYLQAQIHAPVTPGLRVLQGVITPELSDIFRNLRSSLK-------KTFSLPMRGLLKEWLQRLD 290

  Fly   405 ----GPWGYNANVVAMD----------YFSNTN 423
                |    |.|::..|          |:.|.|
 Worm   291 DEEIG----NLNILISDQVDTEFCRLVYYLNIN 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5895NP_648828.3 PI-PLCXDc_CG14945_like 148..435 CDD:176559 65/353 (18%)
F38E9.1NP_510673.1 PI-PLCXD1c 8..317 CDD:176555 63/349 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4306
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13593
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.