DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5895 and plcxd2

DIOPT Version :9

Sequence 1:NP_648828.3 Gene:CG5895 / 39752 FlyBaseID:FBgn0036560 Length:453 Species:Drosophila melanogaster
Sequence 2:XP_002940157.1 Gene:plcxd2 / 100496710 XenbaseID:XB-GENE-5832516 Length:315 Species:Xenopus tropicalis


Alignment Length:344 Identity:66/344 - (19%)
Similarity:126/344 - (36%) Gaps:94/344 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 KIQPNWMGQI-KDINRMALKDIFLPGTHAS---------------AAVLGSSSKSNSI--LVRDY 185
            |...:|||.: ..::.:.|.::.:||:|.|               ||.:...:|.:.:  |::.:
 Frog     4 KCNQDWMGSLPTSLSSLPLANLAIPGSHDSFSYWVDEKSPVGPDQAATIKRIAKISLVKRLMKKW 68

  Fly   186 LVAQQLDVWSQLVFGIRYLDLSIGYKNMNTENDADNFWIANENMLITPLLTV-----LRDVRQFV 245
            .|.|.|....||..||||.||.:..|....         ..|...|..|..:     |.::.:|:
 Frog    69 SVTQNLTFKEQLESGIRYFDLRVSSKPEEA---------GKEIYFIHGLYGIKVWDGLEEINKFL 124

  Fly   246 -KRSGEVVVLDFSSFPIGFYKHPEIYSSLFRLIRQELGDETYRRNVGKDENCANRNFSEILLQKR 309
             :.:.|:|:|||:.|....::| .:|  |..::::..|.:..      ..:|......:.|..|:
 Frog   125 TQHNKEIVLLDFNHFYAMDHEH-HLY--LVNMMQEVFGSKLC------TADCVENITLQYLWGKK 180

  Fly   310 HLVILFPTQELPYPDRESNMLCPPWQRFSTSFMNISQTLDYMRLLFSRKPDSPVRNVGWIFTAVR 374
            :.|::|....|             |.             :|:.|....|..:|..|...:...::
 Frog   181 YQVLIFYHYNL-------------WN-------------EYLYLWSGNKMPAPWANTTNVQKLIQ 219

  Fly   375 SMEQTLNAHQLQ-TAKERAAVLNPKIN-----------------------KWLK--GPWGYNANV 413
            .:|.||.....: |.....|:|.|::.                       .|:|  .|.....|:
 Frog   220 FLETTLTERSKRGTFHVSQAILTPRVKTIVRGLKSGLKNTLVHRNLPVILNWVKMQKPGVMGVNI 284

  Fly   414 VAMDYFSNTNIVDLAIQVN 432
            :..|:....:..:..|::|
 Frog   285 ITSDFVELVDFAETVIRLN 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5895NP_648828.3 PI-PLCXDc_CG14945_like 148..435 CDD:176559 62/335 (19%)
plcxd2XP_002940157.1 PI-PLCXD1c 13..303 CDD:176555 61/333 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.