DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5895 and plcxd3

DIOPT Version :9

Sequence 1:NP_648828.3 Gene:CG5895 / 39752 FlyBaseID:FBgn0036560 Length:453 Species:Drosophila melanogaster
Sequence 2:XP_002940165.2 Gene:plcxd3 / 100485500 XenbaseID:XB-GENE-962063 Length:321 Species:Xenopus tropicalis


Alignment Length:339 Identity:77/339 - (22%)
Similarity:134/339 - (39%) Gaps:92/339 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 WMGQIKD-INRMALKDIFLPGTHAS----------------------AAVLGSSSKSNSILVRDY 185
            ||..:.: |:|:.|..:.:||:|.|                      .:|.|:.:|.   |:|.:
 Frog    15 WMASLPERIHRVPLTSLAIPGSHDSFSFYIDEASPVGPEQPETVQNFVSVFGTVAKK---LMRKW 76

  Fly   186 LVAQQLDVWSQLVFGIRYLDLSIGYKNMNTEND---ADNFWIANENMLITPLLTVLRDVRQFVKR 247
            |..|.::..:||..||||.||.|..|..:.:|:   |...:.|..|..:..:...|.|      .
 Frog    77 LATQTMNFTNQLEAGIRYFDLRISTKPRDPDNELYFAHGLFSAKVNEGLEEINAYLSD------H 135

  Fly   248 SGEVVVLDFSSFPIGFYKHPEIYSSLFRLIRQELGDETYRRNVGKDENC----ANRNFSEILLQK 308
            :.|||.|||:.| .|..|:.  :.:|.:::|...|.:.          |    |.....:.|.::
 Frog   136 TKEVVFLDFNHF-YGMQKYH--HENLVQMLRDIFGKKI----------CPVIFAQEVCLKYLWER 187

  Fly   309 RHLVILF---PTQ-ELPY--PDRESNMLCPPWQRFSTSFMNISQTLDYMRLL-FSRKPDSPVRNV 366
            .:.:::|   |.. |:|:  |   ..|:..||          :.|.|..:|: |.:...:..|..
 Frog   188 NYQILVFYHSPVALEVPFLWP---GQMMPAPW----------ANTTDTEKLIQFLQSSITERRKK 239

  Fly   367 GWIF-----------TAVRSMEQTLNAHQLQTAKERAAVLNPKINKWLK--GPWGYNANVVAMDY 418
            |..|           |.|:.:...|.    :|..|||.   |.:..|::  .|.....|:|..|:
 Frog   240 GSFFISQVVLTPKASTVVKGVASGLR----ETITERAL---PAMMHWVRTQKPGESGINIVTADF 297

  Fly   419 FSNTNIVDLAIQVN 432
            ....:.:...|::|
 Frog   298 VELGDFISTVIRLN 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5895NP_648828.3 PI-PLCXDc_CG14945_like 148..435 CDD:176559 75/335 (22%)
plcxd3XP_002940165.2 PI-PLCXD1c 19..311 CDD:176555 74/333 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13593
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.