DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5895 and LOC100331378

DIOPT Version :9

Sequence 1:NP_648828.3 Gene:CG5895 / 39752 FlyBaseID:FBgn0036560 Length:453 Species:Drosophila melanogaster
Sequence 2:XP_009290935.1 Gene:LOC100331378 / 100331378 -ID:- Length:289 Species:Danio rerio


Alignment Length:351 Identity:69/351 - (19%)
Similarity:113/351 - (32%) Gaps:131/351 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 YNGTELLTVDCLKIQPNWMGQIKDINRMALKDIFLPGTHASAAVLGSSSKSNSILVRDYLVAQQL 191
            :|..|.|::. ...:.:||..:.  ..|.:.:|.:||||.:.|:.|.:             |.:.
Zfish    24 FNDQETLSLP-TNYKTDWMETLD--GNMFISNITIPGTHDTMALHGGA-------------AAEC 72

  Fly   192 DVWS---QLVFGIRYLDLSIGYKNMNTENDADNFWIANENMLITPLLTVLRDVRQFVKRSGEVVV 253
            ..||   ||:.|||||||.:...|:...:.     :.:::       |...||...||       
Zfish    73 QSWSLENQLLAGIRYLDLRVSGNNLKVVHG-----VISQH-------TTFADVLNIVK------- 118

  Fly   254 LDFSSFPIGFYKHPEIYSSLFRLIRQELG--DETYRRNVGKDENC-ANRNFSE--------ILLQ 307
                    ||....:..:.|.|:..:..|  .:.....:..|..| .|....:        :.:|
Zfish   119 --------GFLSQHKSETVLLRVKLESKGPFPDDVANQLKNDPGCWVNNEIPQLEDVRGKIVFVQ 175

  Fly   308 KRHLVILFPTQELPYPDRESNMLCPPWQRFSTSFMNISQTLDYMRLLFSRKPDSPVRNVGWIFTA 372
            |::..:..|..|.                                   .:|.|..|.|       
Zfish   176 KKNFKLGVPLLET-----------------------------------DKKGDYKVGN------- 198

  Fly   373 VRSMEQTLNAH---QLQTAKERAAVLN--------------------PKINKW----LKGPWGYN 410
            |...:..:..|   .|:..:.:|.|||                    .|||.|    |:|....|
Zfish   199 VEKKKAKIIEHLKQALEPCEVKAVVLNYSSGTGWPLGRLDRTPKNVAKKINPWLYSHLEGASKEN 263

  Fly   411 A----NVVAMDYFSNTNIVDLAIQVN 432
            .    .|:||| |...:::.|.|..|
Zfish   264 IKLCFGVIAMD-FPGLDLIQLIISFN 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5895NP_648828.3 PI-PLCXDc_CG14945_like 148..435 CDD:176559 64/330 (19%)
LOC100331378XP_009290935.1 PI-PLCc_BcPLC_like 41..288 CDD:176528 64/331 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D243732at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.