DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5895 and si:dkey-152b24.7

DIOPT Version :9

Sequence 1:NP_648828.3 Gene:CG5895 / 39752 FlyBaseID:FBgn0036560 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001373292.1 Gene:si:dkey-152b24.7 / 100000352 ZFINID:ZDB-GENE-100921-77 Length:288 Species:Danio rerio


Alignment Length:172 Identity:35/172 - (20%)
Similarity:58/172 - (33%) Gaps:82/172 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 WMGQIKDINRMALKDIFLPGTHASAAVLGSSSKSNSILVRDYLVAQQLDVWS---QLVFGIRYLD 205
            ||..:.|  ...:..|.:||||.:.|:.|..             |.:...||   ||..||||||
Zfish    40 WMKTLDD--SKLISHITIPGTHDTMALHGGP-------------AAECQSWSLEDQLKAGIRYLD 89

  Fly   206 LSI---------GYKNMNT-----------------------------------------ENDAD 220
            |.:         |..:.:|                                         :||.|
Zfish    90 LRVNGNDLKLVHGVISQHTTFSDAIDTIKSFLSQHKTEAVLVRVKHQSNGPFPANVLNELKNDPD 154

  Fly   221 NFWIANENMLITPLLTVLRDVRQFVKRSGEVVVLDFSSFPIG 262
             .|::::       :..:|:||      |::|.:..::|.:|
Zfish   155 -CWVSDK-------IPRIREVR------GKIVFVQKNNFKLG 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5895NP_648828.3 PI-PLCXDc_CG14945_like 148..435 CDD:176559 33/168 (20%)
si:dkey-152b24.7NP_001373292.1 PI-PLCc_BcPLC_like 41..287 CDD:176528 34/171 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4306
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.