DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5895 and LOC100000275

DIOPT Version :9

Sequence 1:NP_648828.3 Gene:CG5895 / 39752 FlyBaseID:FBgn0036560 Length:453 Species:Drosophila melanogaster
Sequence 2:XP_009290930.1 Gene:LOC100000275 / 100000275 -ID:- Length:290 Species:Danio rerio


Alignment Length:330 Identity:63/330 - (19%)
Similarity:110/330 - (33%) Gaps:112/330 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 KIQPNWMGQIKDINRMALKDIFLPGTHASAAVLGSSSKSNSILVRDYLVAQQLDVWS---QLVFG 200
            |.:..||..:.| |:: :.:|.:||||.:.|:.|..             |.:...||   ||:.|
Zfish    35 KYKIGWMRSLDD-NKL-ISEINIPGTHDTMALHGGP-------------AAECQSWSLENQLLAG 84

  Fly   201 IRYLDLSIGYKNMNTENDADNFWIANENMLITPLLTVLRDVRQFVKRSGEVVVLDFSSFPIGFYK 265
            :|||||.:...|:...:.     :.:::.....:|.:::                      ||..
Zfish    85 VRYLDLRVSGNNLKVVHG-----VISQHTTFANVLNIVK----------------------GFLS 122

  Fly   266 HPEIYSSLFRLIRQELG--DETYRRNVGKDENCANRN----FSE-----ILLQKRHLVILFPTQE 319
            ..:..:.|.|:..:..|  .:.....:..|..|..||    ..|     :.:||.:..:..|..|
Zfish   123 QHKSETVLLRVKLESKGPFPDDVANQLKNDPGCWVRNKIPRIREVRGKIVFVQKNNFKLGIPMLE 187

  Fly   320 LPYPDRESNMLCPPWQRFSTSFMNISQTLDYMRLLFSRKPDSPVRNVGWIFTAVRSMEQTLN--- 381
               .|::.                     ||.......|.|..:.::.....|.:..|..||   
Zfish   188 ---TDKKG---------------------DYKVGNVENKKDKIIEHLNQALEACKVNEVVLNYSS 228

  Fly   382 ------AHQLQTAKERAAVLNPKINKWLKGPWGYN-------------ANVVAMDYFSNTNIVDL 427
                  ....:|.|:.|..:|         ||.||             ..|:||| |...:::.:
Zfish   229 GTGWPVFRPDKTPKKVAKKIN---------PWLYNNLEGASKMYIKLCFGVIAMD-FPGFDLIQV 283

  Fly   428 AIQVN 432
            .|..|
Zfish   284 IIGFN 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5895NP_648828.3 PI-PLCXDc_CG14945_like 148..435 CDD:176559 60/321 (19%)
LOC100000275XP_009290930.1 PI-PLCc_BcPLC_like 41..288 CDD:176528 60/322 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.