DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Notum and AT1G09550

DIOPT Version :9

Sequence 1:NP_730096.2 Gene:Notum / 39751 FlyBaseID:FBgn0044028 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_172426.2 Gene:AT1G09550 / 837481 AraportID:AT1G09550 Length:388 Species:Arabidopsis thaliana


Alignment Length:389 Identity:100/389 - (25%)
Similarity:172/389 - (44%) Gaps:61/389 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LLLATFSQLPAVCSSSILDAASLQEKDPLRDTSMNMIQRNYMVMHSASGSGDHSRSLKRANLANT 96
            ||...:|.|..:...|||....::..:....|:.|::.....::.:|:..|              
plant     4 LLYWGWSSLAGLILFSILAHGEMKTFNESNGTNANVLMVGLTLVQAAAAKG-------------- 54

  Fly    97 SITCNDGSHAGFYL-RKHPS-SKKWIVLLEGGWHCFDVRSCRSRWMRLRHLMTSSQWPETRDVGG 159
             ..|.|||..|::| |.:.| :..||:.|:||..|..:::|:||  :.....:|:...:.....|
plant    55 -AVCLDGSVPGYHLCRGYGSGANNWIIQLQGGAWCDSIQNCQSR--KGSGYGSSTLMEKELAFLG 116

  Fly   160 ILSPHPEENPYWHNANHVLIPYCSSDSWSGTRTEPDTSDRENSWRFMGALILRQVIAELIPVGLG 224
            :||....|||.::|.|.|.:.||...|:.|     |:.::....::.|..|...|:.:|:..|:.
plant   117 LLSNKAAENPDFYNWNKVKVRYCDGASFDG-----DSENKAAQLQYRGKRIFLAVMEDLMEKGMR 176

  Fly   225 RVPGGELMLVGSSAGGMGVMLNLDRIRDFLVNEKKLQITVRGVSDSGWFLDREPYTPAAVASNEA 289
            :..  :.:|.|.|:||:..:|..|   || .|......||:.:||:|:|||     ...|:...:
plant   177 QAK--QALLSGCSSGGLSAILRCD---DF-NNLFPPTTTVKCMSDAGFFLD-----AVDVSGGHS 230

  Fly   290 VRQ---GWKLWQGL---LPEECTKSYPTEPWRCYYGYRLYPTLKTPLFVFQWLFDEAQMRVDNVG 348
            :|:   |....|||   ||..||..  .:|:.|::...:...:|||||:....||..|  :.|..
plant   231 LRRMYSGVVNTQGLQNTLPPTCTSH--IKPFLCFFPQYIINQVKTPLFILNSGFDSWQ--IGNSL 291

  Fly   349 APVTPQQ---W-----------NYIHEMGGALRSSLDNVSAVFAPSCIGHGVLFKRDWVNIKID 398
            ||.:..:   |           :.:|.:.|...|.||.:......|  .:|||....|.:.:.:
plant   292 APPSADKSGSWHNCSFSFRCTASQMHFLEGFKMSMLDALKTFSKFS--KNGVLITSGWAHCQAE 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NotumNP_730096.2 PAE 99..409 CDD:281299 89/322 (28%)
AT1G09550NP_172426.2 PAE 35..385 CDD:397399 93/358 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 96 1.000 Domainoid score I2451
eggNOG 1 0.900 - - E1_KOG4287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D610784at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2447
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21562
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.