DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Notum and AT5G45280

DIOPT Version :9

Sequence 1:NP_730096.2 Gene:Notum / 39751 FlyBaseID:FBgn0044028 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_199341.1 Gene:AT5G45280 / 834564 AraportID:AT5G45280 Length:391 Species:Arabidopsis thaliana


Alignment Length:323 Identity:90/323 - (27%)
Similarity:138/323 - (42%) Gaps:65/323 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 CNDGSHAGFYLRKHPSS--KKWIVLLEGGWHCFDVRSCRSRWMRLRHLMTSSQWPETRDVG--GI 160
            |.|||...::..|...|  ..|||.:|||..|.|:.:|..|    :..|..|.....:|.|  ||
plant    39 CLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVQR----KSTMKGSSKLMNKDFGFSGI 99

  Fly   161 LSPHPEENPYWHNANHVLIPYCSSDSWSGTRTEPDTSDRENSWRFMGALILRQVIAELIPVGLGR 225
            |......||.::|.|.:.:.||...|::|   :.:..|..:...|.||.:.|.||.:|:..|:..
plant   100 LGGKQSTNPDFYNWNRIKVRYCDGSSFTG---DIEAVDPTHKLFFRGARVWRAVIDDLMAKGMSN 161

  Fly   226 VPGGELMLVGSSAGGMGVMLNLDRIRDFLVNEKKLQITVRGVSDSGWFLDR---------EPYTP 281
            ....  :|.|.|||.:..:|:.|:.:..|....|    |:.|||:|:|:..         :.|..
plant   162 AQNA--ILSGCSAGALAAILHCDQFKSTLPKTAK----VKCVSDAGYFIHGKDITGGSYIQSYYA 220

  Fly   282 AAVASNEAVRQGWKLWQGLLPEECTKSYPTEPWRCYYGYRLYPTLKTPLFVFQWLFDEAQMRVDN 346
            ..||::.:.:.        ||..||.|  .:|..|::...:..||:|||||....||..|::  |
plant   221 KVVATHGSAKS--------LPASCTSS--MKPDLCFFPQYVAKTLQTPLFVINAAFDSWQIK--N 273

  Fly   347 VGAPVT---PQQW-------------------NYIHEMGGAL---RSSLDNVSAVFAPSCIGH 384
            |.||.:   .:.|                   .|..::..||   ||:..|  .:|..||..|
plant   274 VLAPTSVDKSKAWKTCKLDLKKCTAAQLQTVQGYRDQVLAALAPVRSATTN--GLFLDSCHAH 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NotumNP_730096.2 PAE 99..409 CDD:281299 90/323 (28%)
AT5G45280NP_199341.1 PAE 24..368 CDD:281299 90/323 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 96 1.000 Domainoid score I2451
eggNOG 1 0.900 - - E1_KOG4287
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H45335
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D610784at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2447
orthoMCL 1 0.900 - - OOG6_102699
Panther 1 1.100 - - O PTHR21562
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.