DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Notum and AT4G19420

DIOPT Version :9

Sequence 1:NP_730096.2 Gene:Notum / 39751 FlyBaseID:FBgn0044028 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_001328921.1 Gene:AT4G19420 / 827683 AraportID:AT4G19420 Length:432 Species:Arabidopsis thaliana


Alignment Length:270 Identity:73/270 - (27%)
Similarity:122/270 - (45%) Gaps:34/270 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 NLANTSITCNDGSHAGFYLRKHPSS--KKWIVLLEGGWHCFDVRSCRSRWMRLRHLMTSSQWPET 154
            |.......|.|||...::|.:...:  ..|::.||||..|.:|.:|.|| |..| |.:|.:..|.
plant    32 NAVAKGAVCLDGSPPAYHLDRGSGTGINSWLIQLEGGGWCNNVTNCVSR-MHTR-LGSSKKMVEN 94

  Fly   155 RDVGGILSPHPEENPYWHNANHVLIPYCSSDSWSGTRTEPDTSDRENSWRFMGALILRQVIAELI 219
            .....|||...:.||.::|.|.|.:.||...|::|   :.:..:...:..|.||.:...|:.||:
plant    95 LAFSAILSNKKQYNPDFYNWNRVKVRYCDGASFTG---DVEAVNPATNLHFRGARVWLAVMQELL 156

  Fly   220 PVGLGRVPGGELMLVGSSAGGMGVMLNLDRIRDFLVNEKKLQITVRGVSDSGWFLDR-------- 276
            ..|:  :.....:|.|.||||:..:::.|..|..|....|    |:.:||:|:||:.        
plant   157 AKGM--INAENAVLSGCSAGGLASLMHCDSFRALLPMGTK----VKCLSDAGFFLNTRDVSGVQY 215

  Fly   277 -EPYTPAAVASNEAVRQGWKLWQGLLPEECTKSYPTEPWRCYYGYRLYPTLKTPLFVFQWLFDEA 340
             :.|....|..:.:.:.        ||..||..  ..|..|::...:...::||||:....:|..
plant   216 IKTYFEDVVTLHGSAKN--------LPRSCTSR--LTPAMCFFPQYVARQIRTPLFILNAAYDSW 270

  Fly   341 QMRVDNVGAP 350
            |::  |:.||
plant   271 QIK--NILAP 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NotumNP_730096.2 PAE 99..409 CDD:281299 72/263 (27%)
AT4G19420NP_001328921.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 96 1.000 Domainoid score I2451
eggNOG 1 0.900 - - E1_KOG4287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D610784at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2447
orthoMCL 1 0.900 - - OOG6_102699
Panther 1 1.100 - - O PTHR21562
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.