DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Notum and AT4G19410

DIOPT Version :9

Sequence 1:NP_730096.2 Gene:Notum / 39751 FlyBaseID:FBgn0044028 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_001190770.1 Gene:AT4G19410 / 827682 AraportID:AT4G19410 Length:517 Species:Arabidopsis thaliana


Alignment Length:341 Identity:87/341 - (25%)
Similarity:136/341 - (39%) Gaps:75/341 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 CNDGSHAGFYLRKHPSS--KKWIVLLEGGWHCFDVRSCRSRWMRLRHLMTSSQWPETRDVG--GI 160
            |.|||...::..|...|  ..|||.:|||..|.||.||..|    :..|..|.....:|.|  ||
plant    39 CLDGSAPAYHFDKGFGSGVNNWIVHMEGGGWCTDVASCNER----KGTMKGSSKFMNKDFGFSGI 99

  Fly   161 LSPHPEENPYWHNANHVLIPYCSSDSWSGTRTEPDTSDRENSWRFMGALILRQVIAELIPVGLGR 225
            |......||.::|.|.:.:.||...|::|   ..:..:..|...|.||.:.|.|:.:|:..|:..
plant   100 LGGKQSTNPDFYNWNRIKVRYCDGSSFTG---NVEAVNPANKLFFRGARVWRAVVDDLMAKGMKN 161

  Fly   226 VPGGELMLVGSSAGGMGVMLNLDRIRDFLVNEKKLQITVRGVSDSGWFLDR---------EPYTP 281
            ....  :|.|.|||.:..:|:.|..|..|..    ..:|:.|||:|:|:..         :.|..
plant   162 AQNA--ILSGCSAGALAAILHCDTFRAILPR----TASVKCVSDAGYFIHGKDITGGSYIQSYYS 220

  Fly   282 AAVASNEAVRQGWKLWQGLLPEECTKSYPTEPWRCYYGYRLYPTLKTPLFVFQWLFDEAQMRVDN 346
            ..||.:.:.:.        ||..||..  .:|..|::...:.|:::|||||....||..|     
plant   221 KVVALHGSAKS--------LPVSCTSK--MKPELCFFPQYVVPSMRTPLFVINAAFDSWQ----- 270

  Fly   347 VGAPVTPQQWNYIHEMGGALRSSLDNVSAVFAPSCIGHGVLFKRDWVNIKIDDISLPSALRCWEH 411
                                      :..|.||:.:..|    ::|.|.|:|.....:|    :.
plant   271 --------------------------IKNVLAPTAVDKG----KEWKNCKLDLKKCSAA----QL 301

  Fly   412 STRSRRHDKLKRSTEP 427
            .|.....|::.|:..|
plant   302 KTVQGFRDQMMRALSP 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NotumNP_730096.2 PAE 99..409 CDD:281299 83/321 (26%)
AT4G19410NP_001190770.1 PAE 24..368 CDD:281299 87/341 (26%)
PROF 379..495 CDD:294086
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 96 1.000 Domainoid score I2451
eggNOG 1 0.900 - - E1_KOG4287
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H45335
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D610784at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2447
orthoMCL 1 0.900 - - OOG6_102699
Panther 1 1.100 - - O PTHR21562
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.