DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Notum and AT2G46930

DIOPT Version :9

Sequence 1:NP_730096.2 Gene:Notum / 39751 FlyBaseID:FBgn0044028 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_182216.1 Gene:AT2G46930 / 819307 AraportID:AT2G46930 Length:416 Species:Arabidopsis thaliana


Alignment Length:331 Identity:88/331 - (26%)
Similarity:143/331 - (43%) Gaps:71/331 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 ANTSITCNDGSHAGFYLRKHPSS----KKWIVLLEGGWHCFDVRSCRSRWMRLRHLMTSSQWPET 154
            |:....|.||:..|::|  ||.|    .:|::.||||..|...|||..|....|.  :|:...:.
plant    62 ASKGAVCLDGTLPGYHL--HPGSGSGANRWLIQLEGGGWCNTRRSCIFRKTTRRG--SSNHMEKV 122

  Fly   155 RDVGGILSPHPEENPYWHNANHVLIPYCSSDSWSGTRTEPDTSDRENSWRFMGALILRQVIAELI 219
            ....||||....|||.:.|.|.|.:.||...|::|     |:.|..:...:.|..|....:.||:
plant   123 LAFTGILSNKSNENPDFFNWNRVKLRYCDGASFTG-----DSQDESSQLYYRGQRIWHSAMEELL 182

  Fly   220 PVGLGRVPGGELMLVGSSAGGMGVMLNLDRIRDFLVNEKKLQITVRGVSDSGWFLDREPYTPAAV 284
            ..|:.:..  :.:|.|.||||:..:|:.|:.::....    ..||:.:||:|.|:|     ...|
plant   183 SKGMQKAE--QALLSGCSAGGLASILHCDQFKELFPG----TTTVKCLSDAGMFMD-----AVDV 236

  Fly   285 ASNEAVRQGWKLWQGL---------LPEECTKSYPTEPWRCYYGYRLYPTLKTPLFVFQWLFDEA 340
            :...::|   |::||:         |...|||.  .:|..|::...|...:|||:|:....:|..
plant   237 SGGHSLR---KMFQGVVTVQNLQKELSTACTKH--LDPTSCFFPQNLVSGIKTPMFLLNAAYDAW 296

  Fly   341 QMR-------VDNVGAPVTPQQW-----NYIH--------------EMGGALRS-SLDNVSAVFA 378
            |::       ||..|:      |     ::.|              .|..|::| :....:.||.
plant   297 QVQESLAPPSVDLSGS------WKACKSDHSHCNSSQIQFFQDFRTHMVDAVKSFATSTHNGVFI 355

  Fly   379 PSCIGH 384
            .||..|
plant   356 NSCFAH 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NotumNP_730096.2 PAE 99..409 CDD:281299 87/326 (27%)
AT2G46930NP_182216.1 PAE 45..397 CDD:367434 88/331 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 96 1.000 Domainoid score I2451
eggNOG 1 0.900 - - E1_KOG4287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D610784at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2447
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21562
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.