DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Notum and AT3G09405

DIOPT Version :9

Sequence 1:NP_730096.2 Gene:Notum / 39751 FlyBaseID:FBgn0044028 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_001154601.1 Gene:AT3G09405 / 7922320 AraportID:AT3G09405 Length:409 Species:Arabidopsis thaliana


Alignment Length:416 Identity:102/416 - (24%)
Similarity:172/416 - (41%) Gaps:84/416 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SILDAASLQEKDPLRDTSMNMIQRNYMVMHSASGSGDHSRSLKRANLANTSIT---------CND 102
            |:|...:..:.|.|. .|:.::...|....|.:.:.|...|:.|::|....::         |.|
plant     5 SLLQCRTWSKSDWLL-ASIGIVLIVYSFSLSFNSTSDSIPSVDRSDLVKLKLSSKAKERGAFCLD 68

  Fly   103 GSHAGFYLRK--HPSSKKWIVLLEGGWHCFDVRSCRSRWMRLRHLMTSSQWPETRDVGGILSPHP 165
            ||..|::..|  ...|..|::.||||..|..:.||.:|.|  ..|.:|:.:.......|:||..|
plant    69 GSLPGYHFHKGSGSGSNSWLLYLEGGGGCRTIESCSARAM--TRLGSSNFFEHEVPFFGVLSSDP 131

  Fly   166 EENPYWHNANHVLIPYCSSDSWSGTRTEPDTSDRENSWR--FMGALILRQVIAELIPVGLGRVPG 228
            .:||.:.|.|.|:|.||....:||   .|: ::.:|..|  |.|.||...::.||:.:|:.... 
plant   132 SQNPDFFNWNRVMIRYCDGACFSG---HPE-AEFKNETRLFFRGQLIWEAIMDELLSMGMSHAK- 191

  Fly   229 GELMLVGSSAGGMGVMLNLDRIRDFLVNEKKLQITVRGVSDSGWFLD--------------REPY 279
             ..||.|.||||:..:::.|..||.|..:    .||:.|||.|:.|:              .:..
plant   192 -RAMLTGCSAGGLSTLIHCDYFRDHLPKD----ATVKCVSDGGYILNVLDVLGNPTMGSFFHDVV 251

  Fly   280 TPAAVASNEAVRQGWKLWQGLLPEECTKSYPTEPWRCYYGYRLYPTLKTPLFVFQWLFDEAQMRV 344
            |..:|..:             |.:.|...  .||.:|.:.......::||:|:....:|..|  :
plant   252 TLQSVDKS-------------LDQNCVAK--MEPSKCMFPQESLKNIRTPVFLVNTAYDYWQ--I 299

  Fly   345 DNVGAPVTP---QQWNY----IHEMGGA-------LRSSL---------DNVSAVFAPSCIGHGV 386
            .|...|.:|   ::|..    |.|...|       .||||         :....:|..||..| .
plant   300 QNGLVPDSPDLDERWKICRLNIQECDAAQMKVLHGFRSSLIDAIGEFHVNKEGGMFINSCNSH-C 363

  Fly   387 LFKRDW---VNIKIDDISLPSALRCW 409
            ..:..|   .:.:|::.::..::..|
plant   364 QIRESWHSATSTRIENKTIAESVGDW 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NotumNP_730096.2 PAE 99..409 CDD:281299 90/362 (25%)
AT3G09405NP_001154601.1 PAE 48..393 CDD:281299 92/372 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 96 1.000 Domainoid score I2451
eggNOG 1 0.900 - - E1_KOG4287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D610784at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2447
orthoMCL 1 0.900 - - OOG6_102699
Panther 1 1.100 - - O PTHR21562
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.