DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment mib1 and sqst-3

DIOPT Version :9

Sequence 1:	NP_648826.2	Gene:	mib1 / 39750	FlyBaseID:	FBgn0263601	Length:	1226	Species:	Drosophila melanogaster
Sequence 2:	NP_507738.1	Gene:	sqst-3 / 188950	WormBaseID:	WBGene00012067	Length:	229	Species:	Caenorhabditis elegans

Alignment Length:	51	Identity:	22/51 - (43%)
Similarity:	29/51 - (56%)	Gaps:	4/51 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly   179 CDTCRQQPIFGIRWKCAECINYDLCSICYHGDKHHLRHRFYRITTPGGERT 229
            ||:|..| |.|.|:||..|.::|:|..| .....||:|...||:|  |.||
Worm   146 CDSCGTQ-IAGRRYKCTMCADFDICERC-EAKSVHLQHAMLRIST--GLRT 192

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
mib1	NP_648826.2	MIB_HERC2	109..165	CDD:284184
		ZZ_Mind_bomb	177..221	CDD:239079	16/41 (39%)
		MIB_HERC2	248..312	CDD:284184
		Ank_4	568..620	CDD:290365
		ANK repeat	568..598	CDD:293786
		ANK repeat	600..631	CDD:293786
		Ank_2	606..697	CDD:289560
		ANK	628..756	CDD:238125
		ANK repeat	633..664	CDD:293786
		ANK repeat	666..695	CDD:293786
		ANK repeat	699..733	CDD:293786
		Ank_2	704..800	CDD:289560
		ANK	734..872	CDD:238125
		ANK repeat	735..767	CDD:293786
		ANK repeat	769..800	CDD:293786
		Ank_2	774..862	CDD:289560
		ANK repeat	802..862	CDD:293786
		zf-C3HC4_3	968..1011	CDD:290631
		zf-C3HC4_3	1013..1058	CDD:290631
		zf-C3HC4_3	1179..1222	CDD:290631
sqst-3	NP_507738.1	ZZ_NBR1_like	144..186	CDD:239080	16/41 (39%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4582
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900