DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mib1 and Nbr1

DIOPT Version :9

Sequence 1:NP_648826.2 Gene:mib1 / 39750 FlyBaseID:FBgn0263601 Length:1226 Species:Drosophila melanogaster
Sequence 2:XP_006532493.1 Gene:Nbr1 / 17966 MGIID:108498 Length:994 Species:Mus musculus


Alignment Length:77 Identity:22/77 - (28%)
Similarity:35/77 - (45%) Gaps:17/77 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 ILDSAPTGVK---HEGTM------------CDTCRQQPIFGIRWKCAECINYDLCSICYHGD-KH 212
            :|.|:||.|.   .|.|:            |..| |:.|.|:|::|:.|.:|::|..|..|. .|
Mouse   188 LLSSSPTEVSMPISEETLFLPENQFSWHIACSHC-QKRIVGVRYQCSLCPSYNICEDCEAGPYTH 251

  Fly   213 HLRHRFYRITTP 224
            ...|...::..|
Mouse   252 DTNHVLLKLRRP 263

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity