DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS31 and Mrps31

DIOPT Version :9

Sequence 1:NP_524100.1 Gene:mRpS31 / 39749 FlyBaseID:FBgn0036557 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001099561.1 Gene:Mrps31 / 290850 RGDID:1307668 Length:387 Species:Rattus norvegicus


Alignment Length:336 Identity:112/336 - (33%)
Similarity:157/336 - (46%) Gaps:79/336 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KPTKKK-EEP---VETAAQRLNRLLGTMQATDQLSASDFPRPGDANRKRREAQKQEAAAKNVLTA 106
            |.||.: .:|   :|||..||.:.|                 |:..|||.|....|..|     |
  Rat   107 KTTKPRGRQPPAHLETAVGRLQKAL-----------------GEPPRKRNEFLSPELVA-----A 149

  Fly   107 AKNIASMLGTSESDKKQTESELLAKLLGHGSESSSAATGENQTADVSGSPSGDKELNLSDIIVGM 171
            |..:|..|   ..||:.|:||||.:|..| .|.|.|.|...:           :.::.:.||..|
  Rat   150 ASAVADSL---PFDKQTTKSELLKQLQQH-EEESRAQTDRQK-----------RRVSFTQIISNM 199

  Fly   172 KIDRRQQPQQVEQTRGEYVRRSLASRFKPQNRDGAYQRSQRQTKREAES---------FTGSVNL 227
            ||.:                       .|..|..:..:.|.|...|.:|         |.....|
  Rat   200 KIAK-----------------------SPSMRVSSRPQHQIQFDEEVDSSLSQEKPADFRRRKCL 241

  Fly   228 YGGEPLGIFK----DTQLPISNDILSTWSQLSERELSLQASHPPANYFEQMVLWTDQKKVWRFPI 288
            :.|:.|.||.    |.:.|......|.|.....::|:..:..|..|.||:|:.||.:.|:|.||:
  Rat   242 FKGKRLSIFDVKAFDDEAPEPEAAPSLWEIEFAKQLATVSEQPFGNGFEEMIQWTKEGKLWEFPV 306

  Fly   289 NNEQDWEDEHNVDFSEHIFLEQHLEDWCPSKGPIRHFMELVCVGLSKNPYLTAQEKKDHIFWFRD 353
            |||...:|:.: :|.||||||:||||: |.:||||.|||||..||||||||:.::|.:||.|||:
  Rat   307 NNEAGLDDDGS-EFHEHIFLEKHLEDF-PKQGPIRLFMELVTCGLSKNPYLSVRQKVEHIEWFRN 369

  Fly   354 YFQAKKDILRD 364
            ||..|:|||::
  Rat   370 YFNEKRDILKE 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS31NP_524100.1 MRP-S31 60..363 CDD:292073 104/315 (33%)
Mrps31NP_001099561.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..83
MRP-S31 87..379 CDD:292073 111/333 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..228 6/47 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339718
Domainoid 1 1.000 141 1.000 Domainoid score I4624
eggNOG 1 0.900 - - E1_28KG2
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4409
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1584591at2759
OrthoFinder 1 1.000 - - FOG0007379
OrthoInspector 1 1.000 - - oto97742
orthoMCL 1 0.900 - - OOG6_108765
Panther 1 1.100 - - LDO PTHR13231
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5501
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.