DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS31 and MRPS31

DIOPT Version :9

Sequence 1:NP_524100.1 Gene:mRpS31 / 39749 FlyBaseID:FBgn0036557 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_005821.2 Gene:MRPS31 / 10240 HGNCID:16632 Length:395 Species:Homo sapiens


Alignment Length:397 Identity:121/397 - (30%)
Similarity:174/397 - (43%) Gaps:102/397 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GLVNYSSSQ--------------------SKND-----------DGYSSSDDEKPTKKKE----- 52
            |.|.|.||.                    ||.|           :...|.|.||...||:     
Human    39 GTVRYRSSALLARTKNNIQRYFGTNSVICSKKDKQSVRTEETSKETSESQDSEKENTKKDLLGII 103

  Fly    53 ---------EPVETAAQRLNRLLGTMQATDQLSASDFPRPGDANRKRREAQKQ--EAAAKNVLTA 106
                     ..|.|......|.|.:::||          .|...|....|.|:  |..:..::.|
Human   104 KGMKVELSTVNVRTTKPPKRRPLKSLEAT----------LGRLRRATEYAPKKRIEPLSPELVAA 158

  Fly   107 AKNIASMLGTSESDKKQTESELLAKLLGHGSESSSAATGENQTADVSGSPSGDKELNLSDIIVGM 171
            |..:|..|   ..||:.|:||||::|..|..||.:....:.            .:::.|:||..|
Human   159 ASAVADSL---PFDKQTTKSELLSQLQQHEEESRAQRDAKR------------PKISFSNIISDM 208

  Fly   172 KIDRRQQPQQVEQTRGEYVRRSLASRF--KPQNR---DGAYQRSQRQTKREAESFTGSVNLYGGE 231
            |                 |.||..:|.  :|:.|   |..|.....|.|  .:......|::.|:
Human   209 K-----------------VARSATARVRSRPELRIQFDEGYDNYPGQEK--TDDLKKRKNIFTGK 254

  Fly   232 PLGIFK----DTQLPISNDILSTWSQLSERELSLQASHPPANYFEQMVLWTDQKKVWRFPINNEQ 292
            .|.||.    ..:.|.::...|.|.....::|:.....|..|.||:::.||.:.|:|.||||||.
Human   255 RLNIFDMMAVTKEAPETDTSPSLWDVEFAKQLATVNEQPLQNGFEELIQWTKEGKLWEFPINNEA 319

  Fly   293 DWEDEHNVDFSEHIFLEQHLEDWCPSKGPIRHFMELVCVGLSKNPYLTAQEKKDHIFWFRDYFQA 357
            .::|:.: :|.||||||:|||.: |.:||||||||||..||||||||:.::|.:||.|||:||..
Human   320 GFDDDGS-EFHEHIFLEKHLESF-PKQGPIRHFMELVTCGLSKNPYLSVKQKVEHIEWFRNYFNE 382

  Fly   358 KKDILRD 364
            |||||::
Human   383 KKDILKE 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS31NP_524100.1 MRP-S31 60..363 CDD:292073 104/313 (33%)
MRPS31NP_005821.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..97 5/26 (19%)
MRP-S31 96..388 CDD:406004 108/337 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..196 8/20 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145977
Domainoid 1 1.000 144 1.000 Domainoid score I4608
eggNOG 1 0.900 - - E1_28KG2
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4446
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1584591at2759
OrthoFinder 1 1.000 - - FOG0007379
OrthoInspector 1 1.000 - - oto90632
orthoMCL 1 0.900 - - OOG6_108765
Panther 1 1.100 - - LDO PTHR13231
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2939
SonicParanoid 1 1.000 - - X5501
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.