DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hzg and CTDP1

DIOPT Version :9

Sequence 1:NP_001261912.1 Gene:hzg / 39748 FlyBaseID:FBgn0036556 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_004706.3 Gene:CTDP1 / 9150 HGNCID:2498 Length:961 Species:Homo sapiens


Alignment Length:296 Identity:67/296 - (22%)
Similarity:118/296 - (39%) Gaps:78/296 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 DQQRYLLPQVRLTDMHRK---CMVIDLDETLVHSSFKPIPNADFIVPVEIDGTVH--------QV 149
            ||||          :||.   .:::|||:||:|::      ......:...|..|        .:
Human   173 DQQR----------LHRNRKLVLMVDLDQTLIHTT------EQHCQQMSNKGIFHFQLGRGEPML 221

  Fly   150 YVLKRPHVDEFLQKMGELYECVLFTASLAKYADPVADLLD-KWNVFRAR-LFRESCV--YYRGNY 210
            :...|||..:||:|:.:|||..:||.....||..:|..|| :..:|..| |.|:.|:  :.:...
Human   222 HTRLRPHCKDFLEKIAKLYELHVFTFGSRLYAHTIAGFLDPEKKLFSHRILSRDECIDPFSKTGN 286

  Fly   211 IKDLNRLGRDLQKIVIVDNSPASYIFHPDNAVPVKS--WFDDVTDCEL----RELIPLFEKLSKV 269
            :::|...|..:  :.|:|:....:.|.| |.:.||.  :|....|...    ||    .:...||
Human   287 LRNLFPCGDSM--VCIIDDREDVWKFAP-NLITVKKYVYFQGTGDMNAPPGSRE----SQTRKKV 344

  Fly   270 D-SVYSVLCNSNQPLNNQTNQQQHPQELQQAP-----NQLHQQLQQQQQQQTISATTVITQATT- 327
            : |..:.:...:.|:.:       |:.:.|||     |.|.:..::      ::.:...|...: 
Human   345 NHSRGTEVSEPSPPVRD-------PEGVTQAPGVEPSNGLEKPARE------LNGSEAATPRDSP 396

  Fly   328 -------------LSAPTMLNQQQTSPPSPQSELLQ 350
                         ..|||. :|:....|.||....|
Human   397 RPGKPDERDIWPPAQAPTS-SQELAGAPEPQGSCAQ 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hzgNP_001261912.1 HIF-SF_euk 112..270 CDD:274055 44/178 (25%)
CTDP1NP_004706.3 Biotinyl_lipoyl_domains 21..111 CDD:299706
FCP1_euk 177..323 CDD:131304 40/154 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..589 22/122 (18%)
BRCT 636..716 CDD:237994
FCP1_C 716..961 CDD:286402
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 730..752
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 780..949
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.