DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hzg and NEM1

DIOPT Version :9

Sequence 1:NP_001261912.1 Gene:hzg / 39748 FlyBaseID:FBgn0036556 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_011867.1 Gene:NEM1 / 856393 SGDID:S000001046 Length:446 Species:Saccharomyces cerevisiae


Alignment Length:195 Identity:69/195 - (35%)
Similarity:108/195 - (55%) Gaps:19/195 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 LLPQVRLTDMHRKCMVIDLDETLVHSSFKPIPNAD----FIVPVE--IDGTVHQVYVLKRPHVDE 159
            |:|:..|....:|.:||||||||:||:.:...:::    .:|.|:  :.|.....::.|||:.|.
Yeast   240 LIPKSVLNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGLSGIRTLYFIHKRPYCDL 304

  Fly   160 FLQKMGELYECVLFTASLAKYADPVADLLDKW--NVFRARLFRESCVYYRG-NYIKDLNRL---- 217
            ||.|:.:.|:.::||||:.:|||||.|.|:..  :.|..|.:|..||...| .|||||:.:    
Yeast   305 FLTKVSKWYDLIIFTASMKEYADPVIDWLESSFPSSFSKRYYRSDCVLRDGVGYIKDLSIVKDSE 369

  Fly   218 ------GRDLQKIVIVDNSPASYIFHPDNAVPVKSWFDDVTDCELRELIPLFEKLSKVDSVYSVL 276
                  ...|..::|:||||.||..:.|||:.|:.|..|.||.:|..|:|..|.:.....|.::|
Yeast   370 ENGKGSSSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLPFLEAMRYSTDVRNIL 434

  Fly   277  276
            Yeast   435  434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hzgNP_001261912.1 HIF-SF_euk 112..270 CDD:274055 64/176 (36%)
NEM1NP_011867.1 FCP1 9..446 CDD:227517 69/195 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S764
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.