DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hzg and FCP1

DIOPT Version :9

Sequence 1:NP_001261912.1 Gene:hzg / 39748 FlyBaseID:FBgn0036556 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_014004.1 Gene:FCP1 / 855320 SGDID:S000004890 Length:732 Species:Saccharomyces cerevisiae


Alignment Length:273 Identity:57/273 - (20%)
Similarity:110/273 - (40%) Gaps:52/273 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 MVIDLDETLVHSSFKPI----------PN-------------ADFIVP---VEIDGTVHQ----- 148
            :|:|||:|::|....|.          ||             .:.::|   :..||::.:     
Yeast   177 LVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGSMLRPPPVR 241

  Fly   149 ---VYVLKRPHVDEFLQKMGELYECVLFTASLAKYADPVADLLDKWNVFRARLFRESCVYYRGN- 209
               .||..||.:.||..|:..|:|..::|.:...||..:|.::|.    ...||.:..:....| 
Yeast   242 KCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDP----TGELFGDRILSRDENG 302

  Fly   210 --YIKDLNRL-GRDLQKIVIVDNSPASYIFHPD--NAVPVKSWFDDVTDCELRELIPLFEKLSKV 269
              ..|.|.:| ..|...:|::|:....:.:.|:  ..||. ::|..|.|.....|......:.::
Yeast   303 SLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPY-NFFVGVGDINSNFLPKQSTGMLQL 366

  Fly   270 DSVYSVLCNSNQPL------NNQTNQQQHPQELQQAPNQLHQQLQQQQQQQTISATTVITQATTL 328
            ..........:|.|      |.:..|::..:|:::...:|:.||...::.....:...:|:....
Yeast   367 GRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPPANESKEELTKKLEY 431

  Fly   329 SAPTMLNQQQTSP 341
            || ::..|||..|
Yeast   432 SA-SLEVQQQNRP 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hzgNP_001261912.1 HIF-SF_euk 112..270 CDD:274055 42/194 (22%)
FCP1NP_014004.1 Biotinyl_lipoyl_domains 88..>112 CDD:416260
FCP1 150..623 CDD:227517 57/273 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.