DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hzg and PSR2

DIOPT Version :9

Sequence 1:NP_001261912.1 Gene:hzg / 39748 FlyBaseID:FBgn0036556 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_013119.1 Gene:PSR2 / 850706 SGDID:S000004009 Length:397 Species:Saccharomyces cerevisiae


Alignment Length:272 Identity:120/272 - (44%)
Similarity:160/272 - (58%) Gaps:50/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 QVSRDDEQLNVYPSYPNDKDAWLGFSGSVWLPDCPADHAQLTHDVDRLKPQKRGLFHSLLCCWRR 73
            ||.::|.......|.| |.|..|       :|....|.:.|||    |:|.:   :|:       
Yeast   168 QVGQEDMNPQYVASSP-DNDLNL-------IPTTEEDFSDLTH----LQPDQ---YHA------- 210

  Fly    74 NRTKTNQNGTQIDGSTT--PPPLPDQQRYLLPQVRLTDMHRKCMVIDLDETLVHSSFKPIPNADF 136
                        .|..|  ||.|.:.|:            :||:::||||||||||||.:.:|||
Yeast   211 ------------PGYDTLLPPKLQEFQQ------------KKCLILDLDETLVHSSFKYMHSADF 251

  Fly   137 IVPVEIDGTVHQVYVLKRPHVDEFLQKMGELYECVLFTASLAKYADPVADLLDKWNVFRARLFRE 201
            ::|||||..||.|||:|||.|||||.::.:|||.|:||||:::||:|:.|.||.......|||||
Yeast   252 VLPVEIDDQVHNVYVIKRPGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPNGTIHHRLFRE 316

  Fly   202 SCVYYRGNYIKDLNRLGRDLQKIVIVDNSPASYIFHPDNAVPVKSWFDDVTDCELRELIPLFEKL 266
            :|..|.|||||:|:::||.|.:.:|:|||||||||||.:|||:.|||.|..|.||.::|||.|.|
Yeast   317 ACYNYEGNYIKNLSQIGRPLSETIILDNSPASYIFHPQHAVPISSWFSDTHDNELLDIIPLLEDL 381

  Fly   267 S--KVDSVYSVL 276
            |  .|..|.|||
Yeast   382 SSGNVLDVGSVL 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hzgNP_001261912.1 HIF-SF_euk 112..270 CDD:274055 93/159 (58%)
PSR2NP_013119.1 FCP1 5..397 CDD:227517 120/272 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346003
Domainoid 1 1.000 203 1.000 Domainoid score I542
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S764
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000901
OrthoInspector 1 1.000 - - otm46763
orthoMCL 1 0.900 - - OOG6_100959
Panther 1 1.100 - - O PTHR12210
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1679
SonicParanoid 1 1.000 - - X485
TreeFam 1 0.960 - -
1211.680

Return to query results.
Submit another query.