DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hzg and PSR1

DIOPT Version :9

Sequence 1:NP_001261912.1 Gene:hzg / 39748 FlyBaseID:FBgn0036556 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_013091.1 Gene:PSR1 / 850650 SGDID:S000003933 Length:427 Species:Saccharomyces cerevisiae


Alignment Length:167 Identity:95/167 - (56%)
Similarity:129/167 - (77%) Gaps:0/167 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 LLPQVRLTDMHRKCMVIDLDETLVHSSFKPIPNADFIVPVEIDGTVHQVYVLKRPHVDEFLQKMG 165
            |||....:...:||:::||||||||||||.:.:|||::.||||..||.|||:|||.|:|||:::|
Yeast   246 LLPPQDESTKGKKCLILDLDETLVHSSFKYLRSADFVLSVEIDDQVHNVYVIKRPGVEEFLERVG 310

  Fly   166 ELYECVLFTASLAKYADPVADLLDKWNVFRARLFRESCVYYRGNYIKDLNRLGRDLQKIVIVDNS 230
            :|:|.|:||||:::|.||:.|:||...|...|||||:|..|.|||||:|:::||.|..|:|:|||
Yeast   311 KLFEVVVFTASVSRYGDPLLDILDTDKVIHHRLFREACYNYEGNYIKNLSQIGRPLSDIIILDNS 375

  Fly   231 PASYIFHPDNAVPVKSWFDDVTDCELRELIPLFEKLS 267
            ||||||||.:|:|:.|||.|..|.||.::|||.|.||
Yeast   376 PASYIFHPQHAIPISSWFSDTHDNELLDIIPLLEDLS 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hzgNP_001261912.1 HIF-SF_euk 112..270 CDD:274055 92/156 (59%)
PSR1NP_013091.1 FCP1 6..427 CDD:227517 95/167 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346004
Domainoid 1 1.000 203 1.000 Domainoid score I542
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S764
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000901
OrthoInspector 1 1.000 - - otm46763
orthoMCL 1 0.900 - - OOG6_100959
Panther 1 1.100 - - O PTHR12210
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1679
SonicParanoid 1 1.000 - - X485
TreeFam 1 0.960 - -
1211.680

Return to query results.
Submit another query.