DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hzg and AT1G29770

DIOPT Version :9

Sequence 1:NP_001261912.1 Gene:hzg / 39748 FlyBaseID:FBgn0036556 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_174270.1 Gene:AT1G29770 / 839855 AraportID:AT1G29770 Length:278 Species:Arabidopsis thaliana


Alignment Length:210 Identity:83/210 - (39%)
Similarity:122/210 - (58%) Gaps:15/210 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 FHS--LLCCWRRNRTKTNQNGTQIDGSTTPPPLPDQQRYL---LPQVRLTDMHRKCMVIDLDETL 123
            ||:  |.|..|..|..|..:.|    .|..|.:....:.|   .|.:|..| .::.:.:||||||
plant    54 FHNRLLRCVSRFLRLATTSSAT----PTRRPTMKQGYKKLHKREPLIRRND-KKRTIFLDLDETL 113

  Fly   124 VHSSFKPIP---NADFIVPVEIDGTVHQVYVLKRPHVDEFLQKMGELYECVLFTASLAKYADPVA 185
            |||:.:| |   |.||:|.::|:|.|..::|:|||.|.|||:::.:.|...:|||.|.:||..|.
plant   114 VHSTMEP-PIRVNVDFMVRIKIEGAVIPMFVVKRPGVTEFLERISKNYRVAIFTAGLPEYASQVL 177

  Fly   186 DLLDKWNVFRARLFRESCVYYRGNYIKDLNRLGR-DLQKIVIVDNSPASYIFHPDNAVPVKSWFD 249
            |.|||..|...||:|:||....|.|.|||:.:.: ||..:::||::|.||...|||.||:|.:.|
plant   178 DKLDKNRVISQRLYRDSCTEVNGRYAKDLSLVAKNDLGSVLLVDDNPFSYSLQPDNGVPIKPFMD 242

  Fly   250 DVTDCELRELIPLFE 264
            |:.|.||.:|...|:
plant   243 DMEDQELMKLAEFFD 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hzgNP_001261912.1 HIF-SF_euk 112..270 CDD:274055 69/157 (44%)
AT1G29770NP_174270.1 HIF-SF_euk 102..264 CDD:274055 69/157 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 1 1.000 - - FOG0000901
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100959
Panther 1 1.100 - - O PTHR12210
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X485
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.870

Return to query results.
Submit another query.