DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hzg and SSP4

DIOPT Version :9

Sequence 1:NP_001261912.1 Gene:hzg / 39748 FlyBaseID:FBgn0036556 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001119383.1 Gene:SSP4 / 834684 AraportID:AT5G46410 Length:456 Species:Arabidopsis thaliana


Alignment Length:252 Identity:85/252 - (33%)
Similarity:130/252 - (51%) Gaps:19/252 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 WLPDCPADHAQLTHDVDRLKPQKRGLFHSLLCCWRRNRTKTNQNGTQIDGSTTPPPLPDQQRYLL 102
            :|.|..|:...:..|.|::....    |.|...:.|.|:...:...:.:......  .|.|.::.
plant   203 YLEDGSANKDDIKSDTDKINLDN----HDLFLAFNRTRSYNVEPDDRAESEVAED--FDPQLFIK 261

  Fly   103 PQVRLTD----------MHRK--CMVIDLDETLVHSSFKPIPNADFIVPVEIDGTVHQVYVLKRP 155
            .|..|:|          :.:|  .:|:|||||||||:.:....|||...|..:...:.|||.:||
plant   262 NQPELSDVVSNYWPRDTLRKKSVTLVLDLDETLVHSTLESCNVADFSFRVFFNMQENTVYVRQRP 326

  Fly   156 HVDEFLQKMGELYECVLFTASLAKYADPVADLLDKWNVF-RARLFRESCVYYRGNYIKDLNRLGR 219
            |:..||:::|||:..|:||||.:.||..:.|:||....| ..|.:|:||:...|.|.|||..||.
plant   327 HLYRFLERVGELFHVVIFTASHSIYASQLLDILDPDGKFISQRFYRDSCILLDGIYTKDLTVLGL 391

  Fly   220 DLQKIVIVDNSPASYIFHPDNAVPVKSWFDDVTDCELRELIPLFEKLSKVDSVYSVL 276
            ||.|:.|:||.|..|....:|.:|:|||:||.||..|..::|..|.|:..|.|..::
plant   392 DLAKVAIIDNCPQVYRLQINNGIPIKSWYDDPTDDGLITILPFLETLAVADDVRPII 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hzgNP_001261912.1 HIF-SF_euk 112..270 CDD:274055 69/160 (43%)
SSP4NP_001119383.1 HIF-SF_euk 284..443 CDD:274055 68/158 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 164 1.000 Domainoid score I1223
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2492
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X485
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.