DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hzg and SSP5

DIOPT Version :9

Sequence 1:NP_001261912.1 Gene:hzg / 39748 FlyBaseID:FBgn0036556 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001078572.1 Gene:SSP5 / 831059 AraportID:AT5G11860 Length:305 Species:Arabidopsis thaliana


Alignment Length:315 Identity:106/315 - (33%)
Similarity:159/315 - (50%) Gaps:55/315 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SRDDEQLNVYPSYPNDKDAWLGFSGSVWLPDCPADHAQLTHDVDRLKPQKRGLFHSLLCCWRRNR 75
            |||.:..|.|       |..|....|...|:|..|.....:..  :|..|      |.|...|.:
plant     9 SRDLDAQNPY-------DRLLALDTSTVDPNCNLDSVSAIYLA--MKSSK------LECVDERGQ 58

  Fly    76 TKTNQNGTQIDGSTTPPPLPDQQ--------RYL----LPQ----------VRLTDMHRKC---- 114
                      |...|...:.|::        .||    ||.          |.|....|.|    
plant    59 ----------DSLITSVCMEDEEDEELDEFDPYLFIKNLPNLSSVVPTFRPVLLPKQTRSCPPIS 113

  Fly   115 MVIDLDETLVHSSFKPIPNADFIVPVEIDGTVHQVYVLKRPHVDEFLQKMGELYECVLFTASLAK 179
            :|:|||||||||:.:|....||..||..:...|.|||..|||:.||::::..|:|.::||||.:.
plant   114 LVLDLDETLVHSTLEPCGEVDFTFPVNFNEEEHMVYVRCRPHLKEFMERVSRLFEIIIFTASQSI 178

  Fly   180 YADPVADLLD-KWNVFRARLFRESCVYYRGNYIKDLNRLGRDLQKIVIVDNSPASYIFHPDNAVP 243
            ||:.:.::|| |..:||.|::|:|||::.|||:|||:.|||||.:::||||||.::.|..:|.||
plant   179 YAEQLLNVLDPKRKLFRHRVYRDSCVFFDGNYLKDLSVLGRDLSRVIIVDNSPQAFGFQVENGVP 243

  Fly   244 VKSWFDDVTDCELRELIPLFEKLSKVDSVYSVLC---NSNQPLNNQTNQQQHPQE 295
            ::|||:|.:|.||..|:|..|.|..|:.|..::.   |..:.::......::|.|
plant   244 IESWFNDPSDKELLHLLPFLESLIGVEDVRPMIAKKFNLREKIDAAVAAPEYPAE 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hzgNP_001261912.1 HIF-SF_euk 112..270 CDD:274055 76/162 (47%)
SSP5NP_001078572.1 NIF 114..273 CDD:397254 75/158 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 164 1.000 Domainoid score I1223
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 165 1.000 Inparanoid score I1593
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2492
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.