DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hzg and SSP4b

DIOPT Version :9

Sequence 1:NP_001261912.1 Gene:hzg / 39748 FlyBaseID:FBgn0036556 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001031661.2 Gene:SSP4b / 827539 AraportID:AT4G18140 Length:446 Species:Arabidopsis thaliana


Alignment Length:228 Identity:82/228 - (35%)
Similarity:121/228 - (53%) Gaps:27/228 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 RRNRTKTN-----QNGTQIDGSTTPPPLPDQQRYLLPQVRLTDM---------------HRKC-- 114
            |.||:::.     :|.|:.:.:....|    |.:|..|..|.|:               .||.  
plant   210 RINRSRSKNLEAAENHTEAEQTEDFDP----QIFLRNQPELADVVFNYFPDMQQPRDSPKRKAVT 270

  Fly   115 MVIDLDETLVHSSFKPIPNADFIVPVEIDGTVHQVYVLKRPHVDEFLQKMGELYECVLFTASLAK 179
            :|:|||||||||:.:...:.||...|..:...:.|||.:||::..||:::.||:..|:||||.:.
plant   271 LVLDLDETLVHSTLEVCRDTDFSFRVTFNMQENTVYVKQRPYLYRFLERVVELFHVVIFTASHSI 335

  Fly   180 YADPVADLLDKWNVF-RARLFRESCVYYRGNYIKDLNRLGRDLQKIVIVDNSPASYIFHPDNAVP 243
            ||..:.|:||....| ..|.:|:||:...|.|.|||..||.||.|:.||||.|..|....:|.:|
plant   336 YASQLLDILDPDGKFVSQRFYRDSCILSDGIYTKDLTVLGLDLAKVAIVDNCPQVYRLQINNGIP 400

  Fly   244 VKSWFDDVTDCELRELIPLFEKLSKVDSVYSVL 276
            :|||:||.||..|..|:|..|.|:..:.|..|:
plant   401 IKSWYDDPTDDGLITLLPFLETLADANDVRPVI 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hzgNP_001261912.1 HIF-SF_euk 112..270 CDD:274055 69/160 (43%)
SSP4bNP_001031661.2 HIF-SF_euk 269..423 CDD:274055 66/153 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 164 1.000 Domainoid score I1223
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2492
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X485
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.