DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hzg and ublcp1

DIOPT Version :9

Sequence 1:NP_001261912.1 Gene:hzg / 39748 FlyBaseID:FBgn0036556 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_021324596.1 Gene:ublcp1 / 792145 ZFINID:ZDB-GENE-040718-3 Length:371 Species:Danio rerio


Alignment Length:347 Identity:68/347 - (19%)
Similarity:127/347 - (36%) Gaps:108/347 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ITQVSRDDEQLNVYPSYPN------DKDAWLGFSGSVWLPDCPADHAQLTHDVDRLKPQKRGLFH 65
            |..:|.:|..|::..|..:      ::...||..    |...|||......|: :|||       
Zfish    69 INTLSEEDTVLDLKQSIKSLTGVLPERQKLLGLK----LKGKPADDNVKLGDL-KLKP------- 121

  Fly    66 SLLCCWRRNRTKTNQNGTQ---IDGSTTPPPLPDQ----------------------------QR 99
                     .||....||:   ::....|||..|.                            :.
Zfish   122 ---------NTKIMMMGTREESLEDVLAPPPENDDVVNDFDIEEEVTEVENREENLAKIARRVKD 177

  Fly   100 YLLPQVRLTDMHRKCMVIDLDETLV-HSSFKPIPNADFIVPVEIDGTVHQVYVLKRPHVDEFLQK 163
            |.:.::......::.:|:|:|.||. |.|...              |.|:   |.||.:.|||..
Zfish   178 YKVEELNPPRPGKRLLVLDIDYTLFDHKSCAE--------------TGHE---LMRPFLHEFLTS 225

  Fly   164 MGELYECVLFTASLAKYADP------VAD--------LLDKWNVFRARLFRESCVYYR------G 208
            ..|.::.|:::|:..|:.|.      |.|        :||...:......:...|..:      |
Zfish   226 AYEDFDIVIWSATSMKWIDAKMKELGVTDNPNYKITFMLDSAAMITVHTPKRGVVEVKPLGVIWG 290

  Fly   209 NYIKDLNRLGRDLQKIVIVDNSPASYIFHPDNAVPV----KSWFDDVTDCELRELIPLFEKLSKV 269
            .|.:..||     :..::.|:...:::.:|.|.:.:    |:..:...|.||.:|....::::|:
Zfish   291 KYSEFYNR-----KNTIMFDDIGRNFLMNPQNGLKIRPFMKAHLNREKDKELYKLSQYLKEIAKL 350

  Fly   270 DSVYSVLCNSN--QPLNNQTNQ 289
            |. :|.|.:.:  :.|:.:.||
Zfish   351 DD-FSGLNHKHWERYLSKKQNQ 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hzgNP_001261912.1 HIF-SF_euk 112..270 CDD:274055 38/182 (21%)
ublcp1XP_021324596.1 UBQ 59..130 CDD:320785 17/81 (21%)
HAD_IIID1 170..364 CDD:131299 42/216 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.