DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hzg and ctdspla

DIOPT Version :9

Sequence 1:NP_001261912.1 Gene:hzg / 39748 FlyBaseID:FBgn0036556 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_005162767.1 Gene:ctdspla / 751737 ZFINID:ZDB-GENE-060825-333 Length:276 Species:Danio rerio


Alignment Length:292 Identity:168/292 - (57%)
Similarity:204/292 - (69%) Gaps:38/292 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDATSIITQVSRDDEQLNVYPSYPNDKDAWLGFSGSVWLPDCPADHAQLTHDVDRLKPQKRGLFH 65
            ||.|||||||:.           |.:::.         |..|....:|....:.  |.:.|.:|.
Zfish     1 MDNTSIITQVAN-----------PKEEEI---------LSSCQEKVSQSNSSLK--KHRNRSIFS 43

  Fly    66 SLLCCWRRNRTK---TNQNGTQI-----DGSTTPP-------PLPD-QQRYLLPQVRLTDMHRKC 114
            ...||:|....:   ||.....:     |.|::|.       |:|. ..:|:||:|.:.|..:.|
Zfish    44 PFFCCFRDYNAEPPATNNKTCSLPPPAEDNSSSPKCDQVQVIPIPSPPAKYILPEVSINDYGKNC 108

  Fly   115 MVIDLDETLVHSSFKPIPNADFIVPVEIDGTVHQVYVLKRPHVDEFLQKMGELYECVLFTASLAK 179
            :||||||||||||||||.||||||||||||||||||||||||||||||||||::|||||||||||
Zfish   109 VVIDLDETLVHSSFKPISNADFIVPVEIDGTVHQVYVLKRPHVDEFLQKMGEMFECVLFTASLAK 173

  Fly   180 YADPVADLLDKWNVFRARLFRESCVYYRGNYIKDLNRLGRDLQKIVIVDNSPASYIFHPDNAVPV 244
            ||||||||||:|.||||||||||||::||||:|||:||||:|.|::|||||||||||||:|||||
Zfish   174 YADPVADLLDQWGVFRARLFRESCVFHRGNYVKDLSRLGRELNKVIIVDNSPASYIFHPENAVPV 238

  Fly   245 KSWFDDVTDCELRELIPLFEKLSKVDSVYSVL 276
            :|||||:||.||.:|:||||.||:...|||||
Zfish   239 QSWFDDMTDTELLDLLPLFEGLSRETDVYSVL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hzgNP_001261912.1 HIF-SF_euk 112..270 CDD:274055 132/157 (84%)
ctdsplaXP_005162767.1 KCNQ2_u3 14..92 CDD:293248 16/88 (18%)
FCP1 <95..272 CDD:227517 141/176 (80%)
HIF-SF_euk 106..265 CDD:274055 132/158 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594604
Domainoid 1 1.000 287 1.000 Domainoid score I1549
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 322 1.000 Inparanoid score I2487
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 1 1.000 - - FOG0000901
OrthoInspector 1 1.000 - - otm24239
orthoMCL 1 0.900 - - OOG6_100959
Panther 1 1.100 - - O PTHR12210
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X485
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.760

Return to query results.
Submit another query.