DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hzg and Ctdspl

DIOPT Version :9

Sequence 1:NP_001261912.1 Gene:hzg / 39748 FlyBaseID:FBgn0036556 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_598471.3 Gene:Ctdspl / 69274 MGIID:1916524 Length:276 Species:Mus musculus


Alignment Length:293 Identity:167/293 - (56%)
Similarity:202/293 - (68%) Gaps:40/293 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDATSIITQVSRDDEQLNVYPSYPNDKDAWLGFSGSVWLPDCPADHAQLTHDVDRLKPQK-RGLF 64
            ||..:|||||:.           |.:.:|....:|.      .|....::     ||.|: |.:.
Mouse     1 MDGPAIITQVTN-----------PKEDEARSPVAGE------KASQRNIS-----LKKQRGRSIL 43

  Fly    65 HSLLCCWRRNRTK-------------TNQNGTQIDG---STTPPPLPDQQRYLLPQVRLTDMHRK 113
            .|..||:|....:             ..:||....|   ...|.|.| ..:||||:|.:.|..:|
Mouse    44 SSFFCCFRDYNVEAPPANSPSVLPPLVEENGGLQKGDQRQVIPVPSP-PAKYLLPEVTVLDYGKK 107

  Fly   114 CMVIDLDETLVHSSFKPIPNADFIVPVEIDGTVHQVYVLKRPHVDEFLQKMGELYECVLFTASLA 178
            |:||||||||||||||||.|||||||||||||:||||||||||||||||:||:|:||||||||||
Mouse   108 CVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQLFECVLFTASLA 172

  Fly   179 KYADPVADLLDKWNVFRARLFRESCVYYRGNYIKDLNRLGRDLQKIVIVDNSPASYIFHPDNAVP 243
            |||||||||||:|.||||||||||||::||||:|||:||||:|.|::|||||||||||||:||||
Mouse   173 KYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRLGRELSKVIIVDNSPASYIFHPENAVP 237

  Fly   244 VKSWFDDVTDCELRELIPLFEKLSKVDSVYSVL 276
            |:|||||:||.||.:|||.||.||:.|.|||:|
Mouse   238 VQSWFDDMTDTELLDLIPFFEGLSREDDVYSML 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hzgNP_001261912.1 HIF-SF_euk 112..270 CDD:274055 131/157 (83%)
CtdsplNP_598471.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 11/46 (24%)
FCP1 <95..270 CDD:227517 140/174 (80%)
HIF-SF_euk 106..265 CDD:274055 131/158 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849055
Domainoid 1 1.000 287 1.000 Domainoid score I1575
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 314 1.000 Inparanoid score I2547
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 1 1.000 - - FOG0000901
OrthoInspector 1 1.000 - - otm43210
orthoMCL 1 0.900 - - OOG6_100959
Panther 1 1.100 - - O PTHR12210
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1679
SonicParanoid 1 1.000 - - X485
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.