DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hzg and Timm50

DIOPT Version :9

Sequence 1:NP_001261912.1 Gene:hzg / 39748 FlyBaseID:FBgn0036556 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_003748854.1 Gene:Timm50 / 687295 RGDID:1587684 Length:353 Species:Rattus norvegicus


Alignment Length:320 Identity:78/320 - (24%)
Similarity:135/320 - (42%) Gaps:80/320 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PSYPNDKDAW----LGFSGSVWLPDCPADHAQLTHDVDRLKPQKRGLFHSLLCCWRRNRTKTNQN 81
            |||......|    ||..|:|                            |::..:..|  ..::|
  Rat    60 PSYAKKVALWIAGLLGAGGTV----------------------------SIVYIFGNN--PVDEN 94

  Fly    82 GTQIDGSTTPPPLPDQQRYLLPQVRLTDMHRK---CMVID------LDETLVHSSFKPIPNADFI 137
            ||:|      |...|....|:.|:|.|..:.|   .|:|:      |.:.|....::|    .:.
  Rat    95 GTKI------PDEFDSDPILVQQLRRTYKYFKDYRQMIIEPTSPCLLPDPLREPYYQP----PYT 149

  Fly   138 VPVEIDGT-VHQVYVL-------KRPHVDEFLQKMGELYECVLFTASLAKYADPVADLLDKWNVF 194
            :.:|:.|. :|..:.|       |||.::...|::..|||.|:||:.....|.|:.|.:|.....
  Rat   150 LVLELTGVLLHPEWSLATGWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFI 214

  Fly   195 RARLFRESCVYYRGNYIKDLNRLGRDLQKIVIVDNSPASYIFHPDNAVPVKSWFDDVTDCELREL 259
            ..||||::..|..|:::||::.|.||..::|:||....::...|.|.|.::.|..:..|..|.:|
  Rat   215 SYRLFRDATRYMEGHHVKDISCLNRDPARVVVVDCKKEAFRLQPFNGVALRPWDGNSDDRVLLDL 279

  Fly   260 IPLFE--KLSKVDSVYSVL---CNSNQPLNNQTNQQQHPQELQQAPNQLHQQLQQQQQQQ 314
            ....:  .|::|:.|.:||   ...:.||              :|..|...:|:|::||:
  Rat   280 SAFLKTIALNQVEDVRTVLEHYALEDDPL--------------EAFKQRQSRLEQEEQQR 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hzgNP_001261912.1 HIF-SF_euk 112..270 CDD:274055 46/176 (26%)
Timm50XP_003748854.1 HAD_FCP1-like 147..262 CDD:319823 34/114 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.