DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hzg and CTDSP1

DIOPT Version :9

Sequence 1:NP_001261912.1 Gene:hzg / 39748 FlyBaseID:FBgn0036556 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_016860104.1 Gene:CTDSP1 / 58190 HGNCID:21614 Length:409 Species:Homo sapiens


Alignment Length:272 Identity:148/272 - (54%)
Similarity:174/272 - (63%) Gaps:50/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 WLGFSGSV--WLPDCPAD--------HAQLTHDVDRL--------------KPQKRGLFHSLLCC 70
            |.|..|||  :.|..|.|        |.:|......|              ||:.||:.|||.||
Human   114 WAGVGGSVFSFSPCGPQDLDAAPRSAHPRLGLAAPELRARWKGDQKSAASQKPRSRGILHSLFCC 178

  Fly    71 WRRNRTKTNQNGTQIDGSTTP----PPL--------PDQQ--RYLLPQVRLTDMHRKCMVIDLDE 121
            ..|:           ||...|    .||        |.|.  :||||:.:..|..:.|:||||||
Human   179 VCRD-----------DGEALPAHSGAPLLVEENGAIPKQTPVQYLLPEAKAQDSDKICVVIDLDE 232

  Fly   122 TLVHSSFKPIPNADFIVPVEIDGTVHQVYVLKRPHVDEFLQKMGELYECVLFTASLAKYADPVAD 186
            |||||||||:.|||||:||||||.|||||||||||||||||:||||:||||||||||||||||||
Human   233 TLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVAD 297

  Fly   187 LLDKWNVFRARLFRESCVYYRGNYIKDLNRLGRDLQKIVIVDNSPASYIFHPDNAVPVKSWFDDV 251
            |||||..|||||||||||::||||:|||:||||||::::|:|||||||:|||||||.. .|....
Human   298 LLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVSA-GWTGTG 361

  Fly   252 TDCELRELIPLF 263
            |..|.:|.:..|
Human   362 TGAETQEGVSPF 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hzgNP_001261912.1 HIF-SF_euk 112..270 CDD:274055 115/152 (76%)
CTDSP1XP_016860104.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158654
Domainoid 1 1.000 287 1.000 Domainoid score I1592
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H100834
Inparanoid 1 1.050 314 1.000 Inparanoid score I2566
Isobase 1 0.950 - 0 Normalized mean entropy S764
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 1 1.000 - - FOG0000901
OrthoInspector 1 1.000 - - otm41140
orthoMCL 1 0.900 - - OOG6_100959
Panther 1 1.100 - - LDO PTHR12210
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1679
SonicParanoid 1 1.000 - - X485
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.740

Return to query results.
Submit another query.