DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hzg and ctdspl3

DIOPT Version :9

Sequence 1:NP_001261912.1 Gene:hzg / 39748 FlyBaseID:FBgn0036556 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_021335375.1 Gene:ctdspl3 / 571337 ZFINID:ZDB-GENE-141215-56 Length:360 Species:Danio rerio


Alignment Length:272 Identity:91/272 - (33%)
Similarity:135/272 - (49%) Gaps:44/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PADHAQLTHDVDRLKPQKRGLF----HSLLCCWRRNRTKTNQNGT-----QIDGSTTPPPLPDQQ 98
            |..|.:..|  ..|.|..|.|:    |.|..  .|:|.:.|....     ::.|.:...||.:.:
Zfish    81 PVHHLRERH--SSLNPAARSLYSPAVHFLTP--PRDREQPNTGPLFSPEHRVFGYSAASPLSEDE 141

  Fly    99 ----------------------------RYLLPQVRLTDMHRKCMVIDLDETLVHSSFKPIPNAD 135
                                        |.:.|:.|.|.  ...:|:|||||||.||...||:|:
Zfish   142 ENEEVFSPFTFIKNIPNRSQQSRPVSAVRDIPPKTRSTP--AATLVLDLDETLVFSSLNVIPDAE 204

  Fly   136 FIVPVEIDGTVHQVYVLKRPHVDEFLQKMGELYECVLFTASLAKYADPVADLLD-KWNVFRARLF 199
            :..........::|||:.||||.||||.|.:.:|..::|::..:||:.:.|:|| ...:||.||:
Zfish   205 YTFNTRFQDHKYKVYVILRPHVREFLQAMTKHFEMFVYTSAKKEYAEKIVDILDPNKKLFRHRLY 269

  Fly   200 RESCVYYRGNYIKDLNRLGRDLQKIVIVDNSPASYIFHPDNAVPVKSWFDDVTDCELRELIPLFE 264
            ::.|....|:|||||..|.|||.|.||:||:|.::.:|..|.:|:|||..|..|.||::|||..|
Zfish   270 QDDCACVLGHYIKDLTILERDLSKTVILDNAPHTFPYHLMNMIPIKSWIGDQEDRELQKLIPYME 334

  Fly   265 KLSKVDSVYSVL 276
            ||...|...:||
Zfish   335 KLVHADDFRNVL 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hzgNP_001261912.1 HIF-SF_euk 112..270 CDD:274055 69/158 (44%)
ctdspl3XP_021335375.1 Atrophin-1 <19..182 CDD:331285 19/106 (18%)
NIF 183..343 CDD:308590 70/159 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.