DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hzg and Ctdsp2

DIOPT Version :9

Sequence 1:NP_001261912.1 Gene:hzg / 39748 FlyBaseID:FBgn0036556 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001106941.1 Gene:Ctdsp2 / 52468 MGIID:1098748 Length:270 Species:Mus musculus


Alignment Length:301 Identity:157/301 - (52%)
Similarity:191/301 - (63%) Gaps:50/301 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDATSIITQVSRDD-----EQLNVYPSYPNDKDAWLGFSGSVWLPDCPADHAQLTHDVDRLKPQK 60
            |:..|||||..|:|     :|..|..|.|.                               ||:.
Mouse     1 MEHGSIITQARREDALVLTKQGLVSKSSPK-------------------------------KPRG 34

  Fly    61 RGLFHSLLCCWRRNRTKTNQNGTQIDGSTTPPPLP--------DQQRY------LLPQVRLTDMH 111
            |.:|.:||||:.......:.:.|::........:.        ..|.|      |||:|...|..
Mouse    35 RSIFKALLCCFHTQHVVQSSSSTELTHKEEANTIAKSDLLQCLQYQFYQIPGTCLLPEVTEQDQG 99

  Fly   112 RKCMVIDLDETLVHSSFKPIPNADFIVPVEIDGTVHQVYVLKRPHVDEFLQKMGELYECVLFTAS 176
            |.|:||||||||||||||||.||||||||||:||.|||||||||:|||||::||||:||||||||
Mouse   100 RICVVIDLDETLVHSSFKPINNADFIVPVEIEGTTHQVYVLKRPYVDEFLRRMGELFECVLFTAS 164

  Fly   177 LAKYADPVADLLDKWNVFRARLFRESCVYYRGNYIKDLNRLGRDLQKIVIVDNSPASYIFHPDNA 241
            ||||||||.||||:..|||||||||:||:::|.|:|||:||||||:|.||:|||||||||||:||
Mouse   165 LAKYADPVTDLLDRCGVFRARLFREACVFHQGCYVKDLSRLGRDLRKTVILDNSPASYIFHPENA 229

  Fly   242 VPVKSWFDDVTDCELRELIPLFEKLSKVDSVYSVLCNSNQP 282
            |||:|||||:.|.||..|||:||:||..|.||:.|.....|
Mouse   230 VPVQSWFDDMADTELLNLIPVFEELSGTDDVYTSLGQLRAP 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hzgNP_001261912.1 HIF-SF_euk 112..270 CDD:274055 124/157 (79%)
Ctdsp2NP_001106941.1 HIF-SF_euk 100..259 CDD:274055 124/158 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849054
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 1 1.000 - - FOG0000901
OrthoInspector 1 1.000 - - otm43210
orthoMCL 1 0.900 - - OOG6_100959
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1679
SonicParanoid 1 1.000 - - X485
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.640

Return to query results.
Submit another query.