DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hzg and ctdsp2

DIOPT Version :9

Sequence 1:NP_001261912.1 Gene:hzg / 39748 FlyBaseID:FBgn0036556 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001006793.1 Gene:ctdsp2 / 448497 XenbaseID:XB-GENE-951111 Length:271 Species:Xenopus tropicalis


Alignment Length:298 Identity:155/298 - (52%)
Similarity:197/298 - (66%) Gaps:55/298 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDATSIITQVSRDDEQLNVYPSYPNDKDAWLGFSGSVWLPDCPADHAQLTHDVDRLKPQKRGLFH 65
            |:::|||.||.|::..::..|.                          |.......||:.|.:|.
 Frog     1 MESSSIIAQVQREEALVHSKPG--------------------------LVSKSSPKKPRSRSIFK 39

  Fly    66 SLLCCWRRNRTKTNQNGTQIDGSTTPPPLPDQQ-------------RY---------LLPQVRLT 108
            :|.||      .:.||.::..|| ..||:|.::             :|         |||:|...
 Frog    40 ALFCC------LSAQNVSRPAGS-IEPPIPKEETNATPKSDLLQCLQYQFYQIPGTSLLPEVAPK 97

  Fly   109 DMHRKCMVIDLDETLVHSSFKPIPNADFIVPVEIDGTVHQVYVLKRPHVDEFLQKMGELYECVLF 173
            |..:.||||||||||||||||||.||||||||||:||.|||||||||:|||||::||:|||||||
 Frog    98 DKEKICMVIDLDETLVHSSFKPISNADFIVPVEIEGTTHQVYVLKRPYVDEFLERMGQLYECVLF 162

  Fly   174 TASLAKYADPVADLLDKWNVFRARLFRESCVYYRGNYIKDLNRLGRDLQKIVIVDNSPASYIFHP 238
            |||||||||||.|||||..|||:|||||:||:::|.|:|||:||||||:|.||:|||||||||||
 Frog   163 TASLAKYADPVTDLLDKSGVFRSRLFREACVFHQGCYVKDLSRLGRDLKKTVILDNSPASYIFHP 227

  Fly   239 DNAVPVKSWFDDVTDCELRELIPLFEKLSKVDSVYSVL 276
            :|||||:|||||::|.||..|||:||:||..:.:|:.|
 Frog   228 ENAVPVQSWFDDMSDTELLSLIPIFEELSYSEDIYTSL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hzgNP_001261912.1 HIF-SF_euk 112..270 CDD:274055 124/157 (79%)
ctdsp2NP_001006793.1 HIF-SF_euk 101..260 CDD:274055 124/158 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 1 1.000 - - FOG0000901
OrthoInspector 1 1.000 - - otm48346
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1679
SonicParanoid 1 1.000 - - X485
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.