DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hzg and CG12078

DIOPT Version :9

Sequence 1:NP_001261912.1 Gene:hzg / 39748 FlyBaseID:FBgn0036556 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_647795.2 Gene:CG12078 / 38401 FlyBaseID:FBgn0035426 Length:253 Species:Drosophila melanogaster


Alignment Length:181 Identity:58/181 - (32%)
Similarity:96/181 - (53%) Gaps:12/181 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 RLTDMHRKCMVIDLDETLVHSSF-------KPIPNA--DFIVPVEIDGTVHQVYVLKRPHVDEFL 161
            ||:.:.||.:|:|:|.|::.|.|       |.||..  ||...:...|..  :||.|||::|.||
  Fly    64 RLSLVARKTLVLDMDNTMITSWFIKRGKKPKNIPRIAHDFKFYLPAYGAT--IYVYKRPYLDHFL 126

  Fly   162 QKMGELYECVLFTASLAKYADPVADLLDKW-NVFRARLFRESCVYYRGNYIKDLNRLGRDLQKIV 225
            .::.:.|:..:||:....||.|:.|.||:. .:..:||:|:.|:...|.:.|.:.....||..:|
  Fly   127 DRVSKWYDLTVFTSGAEIYASPILDFLDRGRGILNSRLYRQHCIEQFGKWSKSVLLACPDLSNVV 191

  Fly   226 IVDNSPASYIFHPDNAVPVKSWFDDVTDCELRELIPLFEKLSKVDSVYSVL 276
            ::|||.....|:.:||:.:||:.....|..|..|:|..:.|..:..|.|:|
  Fly   192 LLDNSSTECSFNAENAILIKSYEIGCRDEALINLLPFLDALRFMKDVRSML 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hzgNP_001261912.1 HIF-SF_euk 112..270 CDD:274055 53/167 (32%)
CG12078NP_647795.2 HIF-SF_euk 70..237 CDD:274055 53/168 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468339
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D102985at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2492
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12210
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.