DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hzg and Fcp1

DIOPT Version :9

Sequence 1:NP_001261912.1 Gene:hzg / 39748 FlyBaseID:FBgn0036556 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001286846.1 Gene:Fcp1 / 37925 FlyBaseID:FBgn0035026 Length:880 Species:Drosophila melanogaster


Alignment Length:310 Identity:68/310 - (21%)
Similarity:104/310 - (33%) Gaps:113/310 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 KTNQNGTQIDGST----TPPPLP-----------DQQRYLLPQVRLTDMHRKCMVIDLDETLVHS 126
            :.|:||...:.|.    |.|.|.           |..|.||...:|.      :::|||:|::|:
  Fly   163 RQNENGQTSEASVPMVHTMPDLKVTQKLAQKLGHDDTRRLLADRKLV------LLVDLDQTVIHT 221

  Fly   127 SFKPIPNADFIVPVEIDGTVH-QVY--------VLKRPHVDEFLQKMGELYECVLFTASLAKYAD 182
            :...:|:       .|.|..| |:|        ...||...|||::|.:|||..:.|.....||.
  Fly   222 TNDTVPD-------NIKGIYHFQLYGPHSPWYHTRLRPGTAEFLERMSQLYELHICTFGARNYAH 279

  Fly   183 PVADLLDKWNVFRAR--LFRESCV----------------------------------------- 204
            .:|.|||....|.:.  |.|:.|.                                         
  Fly   280 MIAQLLDPEGKFFSHRILSRDECFNATSKTDNLKALFPNGDSMVCIIDDREDVWNMASNLIQVKP 344

  Fly   205 YYRGNYIKDLNR-----------LGRDLQKIV----IVDNSPASYIFHP------DNAVPVKSWF 248
            |:...:..|:|.           .|.|.::|.    ..|.:.:|....|      ||.|...|..
  Fly   345 YHFFQHTGDINAPPGLSKHELDGEGVDFKEITEKHGDKDKTESSSEVKPEDTDKGDNTVTSTSKD 409

  Fly   249 DDVTDCELRELIPLFE--------KLSKVDSVYSVLCNSNQPLNNQTNQQ 290
            |||.:    |.:.:||        ::|...|...........||.:||.:
  Fly   410 DDVNE----ESVDVFEIEGDAKDPEVSNASSATEAPKEPRDKLNGKTNAE 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hzgNP_001261912.1 HIF-SF_euk 112..270 CDD:274055 51/238 (21%)
Fcp1NP_001286846.1 Biotinyl_lipoyl_domains 59..142 CDD:299706
FCP1_euk 202..348 CDD:131304 35/158 (22%)
COG5275 481..>658 CDD:227600
BRCT 587..665 CDD:278934
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.