DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hzg and Ctdsp1

DIOPT Version :9

Sequence 1:NP_001261912.1 Gene:hzg / 39748 FlyBaseID:FBgn0036556 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001121551.1 Gene:Ctdsp1 / 363249 RGDID:1305629 Length:261 Species:Rattus norvegicus


Alignment Length:291 Identity:163/291 - (56%)
Similarity:206/291 - (70%) Gaps:43/291 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDATSIITQVSRDDEQLNVYPSYPNDKDAWLGFSGSVWLPDCPADHAQLTHDVDRLKPQKRGLFH 65
            ||::::|||:|: :|.........:.|.|                       |.: ||:.||:.|
  Rat     1 MDSSAVITQISK-EEARGPLRGKGDQKSA-----------------------VSQ-KPRSRGILH 40

  Fly    66 SLLCCWRRNRTKTNQNGTQIDGSTTPPPLPDQQ---------RYLLPQVRLTDMHRKCMVIDLDE 121
            ||.||..|:      :|..:...:..|.|.::.         :||||:|:..|..:.|:||||||
  Rat    41 SLFCCVCRD------DGEPLPAHSGAPLLVEENGAIPKHTPVQYLLPEVKAQDSDKICVVIDLDE 99

  Fly   122 TLVHSSFKPIPNADFIVPVEIDGTVHQVYVLKRPHVDEFLQKMGELYECVLFTASLAKYADPVAD 186
            |||||||||:.|||||:||||||.|||||||||||||||||:||||:||||||||||||||||||
  Rat   100 TLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVAD 164

  Fly   187 LLDKWNVFRARLFRESCVYYRGNYIKDLNRLGRDLQKIVIVDNSPASYIFHPDNAVPVKSWFDDV 251
            |||||..|||||||||||::||||:|||:||||||::::|:|||||||:|||||||||.||||::
  Rat   165 LLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNM 229

  Fly   252 TDCELRELIPLFEKLSKVDSVYSVLCNSNQP 282
            :|.||.:|:|.||:||:||.|||||   .||
  Rat   230 SDTELHDLLPFFEQLSRVDDVYSVL---RQP 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hzgNP_001261912.1 HIF-SF_euk 112..270 CDD:274055 125/157 (80%)
Ctdsp1NP_001121551.1 HIF-SF_euk 90..249 CDD:274055 126/158 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352662
Domainoid 1 1.000 282 1.000 Domainoid score I1581
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H100834
Inparanoid 1 1.050 316 1.000 Inparanoid score I2478
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 1 1.000 - - FOG0000901
OrthoInspector 1 1.000 - - oto96766
orthoMCL 1 0.900 - - OOG6_100959
Panther 1 1.100 - - LDO PTHR12210
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X485
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.