DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hzg and Ublcp1

DIOPT Version :9

Sequence 1:NP_001261912.1 Gene:hzg / 39748 FlyBaseID:FBgn0036556 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001014139.1 Gene:Ublcp1 / 360514 RGDID:1310386 Length:318 Species:Rattus norvegicus


Alignment Length:337 Identity:63/337 - (18%)
Similarity:116/337 - (34%) Gaps:127/337 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ITQVSRDDEQLN----------VYPSYPNDKDAWLGFSGSVWLPDCPADHAQLTHDVD----RLK 57
            :|.:|.||..|:          |.|    ::...||..    :...||:     :||.    :||
  Rat    16 VTTLSEDDTVLDLKQFLKTLTGVLP----ERQKLLGLK----VKGKPAE-----NDVKLGALKLK 67

  Fly    58 PQKRGLFHSLLCCWRRNRTKTNQNGTQ---IDGSTTPPP-----------------LPDQQRYLL 102
            |                .||....||:   ::....|||                 :.:::..||
  Rat    68 P----------------NTKIMMMGTREESLEDVLCPPPDNDDVINDFDIEDEVVEVENREENLL 116

  Fly   103 PQVRLTDMH-----------RKCMVIDLDETLV-HSSFKPIPNADFIVPVEIDGTVHQVYVLKRP 155
            ...|....:           :|.:|:|:|.||. |.|...       ..||          |.||
  Rat   117 KISRRVKEYKVEVLNPPREGKKLLVLDVDYTLFDHRSCAE-------TGVE----------LMRP 164

  Fly   156 HVDEFLQKMGELYECVLFTASLAKYAD--------------PVADLLDKWNVFRARLFRESCVYY 206
            ::.|||....|.|:.|:::|:..|:.:              .:..:||...:......|...:  
  Rat   165 YLHEFLTSAYEDYDIVIWSATNMKWIEAKMKELGVSTNANYKITFMLDSAAMITVHTPRRGLI-- 227

  Fly   207 RGNYIKDLNRLG---------RDLQKIVIVDNSPASYIFHPDNAVPV----KSWFDDVTDCELRE 258
                  |:..||         ...:..::.|:...:::.:|.|.:.:    |:..:...|.||.:
  Rat   228 ------DVKPLGVIWGKFSEFYSKKNTIMFDDIGRNFLMNPQNGLKIRPFMKAHLNRDKDKELVK 286

  Fly   259 LIPLFEKLSKVD 270
            |....::::|:|
  Rat   287 LTQYLKEIAKLD 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hzgNP_001261912.1 HIF-SF_euk 112..270 CDD:274055 36/185 (19%)
Ublcp1NP_001014139.1 Ubl_UBLCP1 3..77 CDD:340511 18/89 (20%)
HAD_IIID1 117..311 CDD:131299 38/207 (18%)
Phosphatase. /evidence=ECO:0000250 133..294 35/185 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.