DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hzg and Ctdspl2

DIOPT Version :9

Sequence 1:NP_001261912.1 Gene:hzg / 39748 FlyBaseID:FBgn0036556 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_997615.1 Gene:Ctdspl2 / 329506 MGIID:1196405 Length:465 Species:Mus musculus


Alignment Length:182 Identity:84/182 - (46%)
Similarity:115/182 - (63%) Gaps:3/182 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 PPLPDQQRYLLPQVRLTDMHRK--CMVIDLDETLVHSSFKPIPNADFIVPVEIDGTVHQVYVLKR 154
            |||.::|....|.:.|......  .:|:||||||||.|...:.:|....||.....::||||..|
Mouse   264 PPLTEEQLNRKPALPLKTRSTPEFSLVLDLDETLVHCSLNELEDAALTFPVLFQDVIYQVYVRLR 328

  Fly   155 PHVDEFLQKMGELYECVLFTASLAKYADPVADLLD-KWNVFRARLFRESCVYYRGNYIKDLNRLG 218
            |...|||::|.::||.:|||||...|||.:.::|| |..:.|.|||||.||..:||||||||.||
Mouse   329 PFFREFLERMSQMYEIILFTASKKVYADKLLNILDPKKQLVRHRLFREHCVCVQGNYIKDLNILG 393

  Fly   219 RDLQKIVIVDNSPASYIFHPDNAVPVKSWFDDVTDCELRELIPLFEKLSKVD 270
            |||.|.:|:||||.::.:...|.:|::|||.|..|.||.:|||..|||.:::
Mouse   394 RDLSKTIIIDNSPQAFAYQLSNGIPIESWFMDKNDNELLKLIPFLEKLVELN 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hzgNP_001261912.1 HIF-SF_euk 112..270 CDD:274055 78/160 (49%)
Ctdspl2NP_997615.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..133
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..239
HIF-SF_euk 286..447 CDD:274055 78/160 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.