DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hzg and ctdsp2

DIOPT Version :9

Sequence 1:NP_001261912.1 Gene:hzg / 39748 FlyBaseID:FBgn0036556 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_955838.1 Gene:ctdsp2 / 321465 ZFINID:ZDB-GENE-030131-184 Length:258 Species:Danio rerio


Alignment Length:296 Identity:158/296 - (53%)
Similarity:188/296 - (63%) Gaps:57/296 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TSIITQVSRDDEQLNVYPSYPNDKDAWLGFSGSVWLPDCPADHAQLTHDVDRLKPQK---RGLFH 65
            :||||||.|:|.:|                             :..|..|::..|||   |.:|.
Zfish     3 SSIITQVQREDTRL-----------------------------SSKTDQVNKSSPQKPGSRNIFK 38

  Fly    66 SLLCCWRRNRT------------KTNQNGT--QIDGSTTPPPLPDQQRYLLPQVRLTDMHRKCMV 116
            .|:||.|....            :...|||  :|.|.:           |||.|...|..:.|:|
Zfish    39 KLICCLRAQDAQLPTSPTHDALLEPEDNGTFAKIPGES-----------LLPAVTSHDQGKICVV 92

  Fly   117 IDLDETLVHSSFKPIPNADFIVPVEIDGTVHQVYVLKRPHVDEFLQKMGELYECVLFTASLAKYA 181
            |||||||||||||||.||||||||||:||.|||||||||:||||||:||||:|||||||||||||
Zfish    93 IDLDETLVHSSFKPISNADFIVPVEIEGTTHQVYVLKRPYVDEFLQRMGELFECVLFTASLAKYA 157

  Fly   182 DPVADLLDKWNVFRARLFRESCVYYRGNYIKDLNRLGRDLQKIVIVDNSPASYIFHPDNAVPVKS 246
            |||.||||:..|||.||||||||:|:|.|:|||:||||:|.|.:|:|||||||||||:|||||.|
Zfish   158 DPVTDLLDQCGVFRTRLFRESCVFYQGCYVKDLSRLGRELHKTLILDNSPASYIFHPENAVPVLS 222

  Fly   247 WFDDVTDCELRELIPLFEKLSKVDSVYSVLCNSNQP 282
            ||||..|.||..|||:||:||:.:.|||.|.....|
Zfish   223 WFDDSEDTELLHLIPVFEELSQAEDVYSRLQQLRAP 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hzgNP_001261912.1 HIF-SF_euk 112..270 CDD:274055 123/157 (78%)
ctdsp2NP_955838.1 FCP1 <64..253 CDD:227517 136/199 (68%)
HIF-SF_euk 88..247 CDD:274055 123/158 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594603
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 322 1.000 Inparanoid score I2487
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 1 1.000 - - FOG0000901
OrthoInspector 1 1.000 - - otm24239
orthoMCL 1 0.900 - - OOG6_100959
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1679
SonicParanoid 1 1.000 - - X485
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.690

Return to query results.
Submit another query.