DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hzg and ttm50

DIOPT Version :9

Sequence 1:NP_001261912.1 Gene:hzg / 39748 FlyBaseID:FBgn0036556 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001303557.1 Gene:ttm50 / 31266 FlyBaseID:FBgn0250874 Length:428 Species:Drosophila melanogaster


Alignment Length:284 Identity:71/284 - (25%)
Similarity:121/284 - (42%) Gaps:76/284 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 RTKTNQNGTQIDGSTTPPPLPDQ------------QRY--------LLP--------QVRLTDMH 111
            :.:.:.||..|:...|..||..|            ||.        |||        |.|.|   
  Fly   169 KPEVDPNGQPIEDEFTHKPLVQQYLQRMWKSIHYYQRMIQEPSRAKLLPDPLKPPYVQPRYT--- 230

  Fly   112 RKCMVIDLDETLVHSS--------FKPIPNADFIVPVEIDGTVHQVYVLKRPHVDEFLQKMGELY 168
               :|:::.:.|||..        ||                       |||.||.||.:..:.:
  Fly   231 ---LVLEMKDVLVHPDWTYQTGWRFK-----------------------KRPGVDHFLAECAKDF 269

  Fly   169 ECVLFTASLAKYADPVADLLDKWNVFRARLFRESCVYYRGNYIKDLNRLGRDLQKIVIVDNSPAS 233
            |.|:|||.......|:.|.||.......||.|::..:..|:::|:|:.|.|||:|:::||....:
  Fly   270 EIVVFTAEQGMTVFPILDALDPNGYIMYRLVRDATHFVDGHHVKNLDNLNRDLKKVIVVDWDANA 334

  Fly   234 YIFHPDNAVPVKSWFDDVTDCELRELIPLFEKLSK--VDSVYSVLCNSNQ---PLNN-QTNQQQH 292
            ...||||...:..|..:..|.:|.:||...:.:::  ||.|..||....|   |:|. :.||::.
  Fly   335 TKMHPDNTFGLARWHGNDDDGQLLDLIAFLKIIAQNNVDDVREVLHYYRQFDDPINQFRENQRKL 399

  Fly   293 PQELQQAPNQLHQQLQQQQQQQTI 316
            .:::.:|     ::::|.:.:..:
  Fly   400 AEQMLEA-----ERIEQSKTKPMV 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hzgNP_001261912.1 HIF-SF_euk 112..270 CDD:274055 44/167 (26%)
ttm50NP_001303557.1 CPDc 227..355 CDD:214729 42/156 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461631
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12210
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.