DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hzg and Ctdspl2

DIOPT Version :9

Sequence 1:NP_001261912.1 Gene:hzg / 39748 FlyBaseID:FBgn0036556 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_038960896.1 Gene:Ctdspl2 / 311368 RGDID:1309219 Length:478 Species:Rattus norvegicus


Alignment Length:182 Identity:84/182 - (46%)
Similarity:115/182 - (63%) Gaps:3/182 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 PPLPDQQRYLLPQVRLTDMHRK--CMVIDLDETLVHSSFKPIPNADFIVPVEIDGTVHQVYVLKR 154
            |||.::|....|.:.|......  .:|:||||||||.|...:.:|....||.....::||||..|
  Rat   277 PPLTEEQLNRKPALPLKTRSTPEFSLVLDLDETLVHCSLNELEDAALTFPVLFQDVIYQVYVRLR 341

  Fly   155 PHVDEFLQKMGELYECVLFTASLAKYADPVADLLD-KWNVFRARLFRESCVYYRGNYIKDLNRLG 218
            |...|||::|.::||.:|||||...|||.:.::|| |..:.|.|||||.||..:||||||||.||
  Rat   342 PFFREFLERMSQMYEIILFTASKKVYADKLLNILDPKKQLVRHRLFREHCVCVQGNYIKDLNILG 406

  Fly   219 RDLQKIVIVDNSPASYIFHPDNAVPVKSWFDDVTDCELRELIPLFEKLSKVD 270
            |||.|.:|:||||.::.:...|.:|::|||.|..|.||.:|||..|||.:::
  Rat   407 RDLSKTIIIDNSPQAFAYQLSNGIPIESWFMDKNDNELLKLIPFLEKLVELN 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hzgNP_001261912.1 HIF-SF_euk 112..270 CDD:274055 78/160 (49%)
Ctdspl2XP_038960896.1 HIF-SF_euk 299..460 CDD:274055 78/160 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.