DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hzg and Ctdnep1

DIOPT Version :9

Sequence 1:NP_001261912.1 Gene:hzg / 39748 FlyBaseID:FBgn0036556 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_017452582.2 Gene:Ctdnep1 / 287447 RGDID:1310172 Length:285 Species:Rattus norvegicus


Alignment Length:181 Identity:80/181 - (44%)
Similarity:111/181 - (61%) Gaps:13/181 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LPQVRLTDMHRKCMVIDLDETLVHS--------SFKPIPNADFIVPVEIDGTVHQVYVLKRPHVD 158
            |.:.||..:.||.:|:||||||:||        :.:|....|||:.|.||....:.:|.||||||
  Rat    83 LSRNRLAQVKRKILVLDLDETLIHSHHDGVLRPTVRPGTPPDFILKVVIDKHPVRFFVHKRPHVD 147

  Fly   159 EFLQKMGELYECVLFTASLAKYADPVADLLD-KWNVFRARLFRESCVYYRGNYIKDLNRLGRDLQ 222
            .||:.:.:.||.|:||||:..|...|||.|| ..::.:.|.:|:.|....|:|||||:.:..||.
  Rat   148 FFLEVVSQWYELVVFTASMEIYGSAVADKLDNSRSILKRRYYRQHCTLELGSYIKDLSVVHSDLS 212

  Fly   223 KIVIVDNSPASYIFHP----DNAVPVKSWFDDVTDCELRELIPLFEKLSKV 269
            .|||:||||.:|..||    |||:|:||||.|.:|..|..|:|:.:.||.|
  Rat   213 SIVILDNSPGAYRSHPGMGKDNAIPIKSWFSDPSDTALLNLLPMLDALSAV 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hzgNP_001261912.1 HIF-SF_euk 112..270 CDD:274055 77/171 (45%)
Ctdnep1XP_017452582.2 HIF-SF_euk 93..263 CDD:274055 76/169 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.