DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hzg and CTDNEP1

DIOPT Version :9

Sequence 1:NP_001261912.1 Gene:hzg / 39748 FlyBaseID:FBgn0036556 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001137247.1 Gene:CTDNEP1 / 23399 HGNCID:19085 Length:244 Species:Homo sapiens


Alignment Length:209 Identity:88/209 - (42%)
Similarity:120/209 - (57%) Gaps:24/209 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 RY-LLP-----QVRLTDMHRKCMVIDLDETLVHS--------SFKPIPNADFIVPVEIDGTVHQV 149
            || :||     :.||..:.||.:|:||||||:||        :.:|....|||:.|.||....:.
Human    42 RYDILPLSPVSRNRLAQVKRKILVLDLDETLIHSHHDGVLRPTVRPGTPPDFILKVVIDKHPVRF 106

  Fly   150 YVLKRPHVDEFLQKMGELYECVLFTASLAKYADPVADLLD-KWNVFRARLFRESCVYYRGNYIKD 213
            :|.||||||.||:.:.:.||.|:||||:..|...|||.|| ..::.:.|.:|:.|....|:||||
Human   107 FVHKRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNSRSILKRRYYRQHCTLELGSYIKD 171

  Fly   214 LNRLGRDLQKIVIVDNSPASYIFHPDNAVPVKSWFDDVTDCELRELIPLFEKLSKVDSVYSVLCN 278
            |:.:..||..|||:||||.:|..|||||:|:||||.|.:|..|..|:|:.:.|.....|.|||  
Human   172 LSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVL-- 234

  Fly   279 SNQPLNNQTNQQQH 292
                   ..|..||
Human   235 -------SRNLHQH 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hzgNP_001261912.1 HIF-SF_euk 112..270 CDD:274055 75/166 (45%)
CTDNEP1NP_001137247.1 HIF-SF_euk 61..229 CDD:274055 75/167 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.