DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hzg and scpl-4

DIOPT Version :9

Sequence 1:NP_001261912.1 Gene:hzg / 39748 FlyBaseID:FBgn0036556 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_505722.1 Gene:scpl-4 / 179481 WormBaseID:WBGene00011897 Length:452 Species:Caenorhabditis elegans


Alignment Length:229 Identity:67/229 - (29%)
Similarity:104/229 - (45%) Gaps:41/229 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 PPPLPDQQRYLLPQVRLTDMHRKCMVIDLDETLVHSSFKPIPNADFIVPVEIDGTVHQVY-VLKR 154
            |.|||  ..||.|:..:        ||:|...|||..:                |....| .|||
 Worm   236 PDPLP--APYLQPKYTI--------VIELKNILVHPEW----------------TYKTGYRFLKR 274

  Fly   155 PHVDEFLQKMG-ELYECVLFTASLAKYADPVADLLDKWNVFRARLFRESCVYYRGNYIKDLNRLG 218
            |.:|.||..:| ..:|.|::::.....|.||.|..|.......:|||:...|..|:::|||::|.
 Worm   275 PALDYFLDVIGYPNFEVVIYSSESMMTAAPVVDSFDPKQRIMYKLFRDCTKYMNGHHVKDLSKLN 339

  Fly   219 RDLQKIVIVDNSPASYIFHPDNAVPVKSW---FDDVTDCELRELIPLFEKLSKVDSVYSVLCNSN 280
            |||.|::.:|....|...:|:|.:.|..|   .||.:..:|.||:.... ||..:.|        
 Worm   340 RDLSKVIYIDFDAKSGQLNPENMLRVPEWKGNMDDTSLVDLAELLKTIH-LSDAEDV-------- 395

  Fly   281 QPLNNQTNQQQHP-QELQQAPNQLHQQLQQQQQQ 313
            :|:....:|...| :|.::....|.||.:|::||
 Worm   396 RPMLQYYSQYDDPAKEFRRRAVYLSQQEEQKKQQ 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hzgNP_001261912.1 HIF-SF_euk 112..270 CDD:274055 49/162 (30%)
scpl-4NP_505722.1 NIF 248..396 CDD:281081 50/180 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.