DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hzg and ctdspl

DIOPT Version :9

Sequence 1:NP_001261912.1 Gene:hzg / 39748 FlyBaseID:FBgn0036556 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_031759361.1 Gene:ctdspl / 100487887 XenbaseID:XB-GENE-1013061 Length:276 Species:Xenopus tropicalis


Alignment Length:303 Identity:169/303 - (55%)
Similarity:209/303 - (68%) Gaps:53/303 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDATSIITQVSRDDEQLNVYPSYPNDKDAWLGFSGSVWLPDCPADHAQLTHDVDRLKPQKRGLFH 65
            ||.||||||||             |.|:..:.......:..|         ::...|.:.|.:|.
 Frog     1 MDNTSIITQVS-------------NPKEEGILSCAQEKVSQC---------NISLKKQRNRSIFS 43

  Fly    66 SLLCCWRRNRTK---TNQNGTQIDGSTTPPPLPDQQ-------------------RYLLPQVRLT 108
            ||.||:|....:   :|.|.:.:      |||.::.                   :||||:::::
 Frog    44 SLFCCFRSYSVEPPTSNNNSSPL------PPLVEENGGIQKADQTQALTIPSPPAKYLLPELKVS 102

  Fly   109 DMHRKCMVIDLDETLVHSSFKPIPNADFIVPVEIDGTVHQVYVLKRPHVDEFLQKMGELYECVLF 173
            |..:||:||||||||||||||||.|||||||||||||:|||||||||||||||||||||:|||||
 Frog   103 DYGKKCVVIDLDETLVHSSFKPINNADFIVPVEIDGTIHQVYVLKRPHVDEFLQKMGELFECVLF 167

  Fly   174 TASLAKYADPVADLLDKWNVFRARLFRESCVYYRGNYIKDLNRLGRDLQKIVIVDNSPASYIFHP 238
            ||||||||||||||||:|.||.|||||||||::||||:|||:||||:|.|::|:|||||||||||
 Frog   168 TASLAKYADPVADLLDRWGVFNARLFRESCVFHRGNYVKDLSRLGRELSKVIIIDNSPASYIFHP 232

  Fly   239 DNAVPVKSWFDDVTDCELRELIPLFEKLSKVDSVYSV---LCN 278
            :|||||:|||||:||.||.:|||.||.|||.|:||::   |||
 Frog   233 ENAVPVQSWFDDMTDTELLDLIPFFEGLSKEDNVYNMLNKLCN 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hzgNP_001261912.1 HIF-SF_euk 112..270 CDD:274055 132/157 (84%)
ctdsplXP_031759361.1 HIF-SF_euk 106..264 CDD:274055 132/157 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 288 1.000 Domainoid score I1551
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 316 1.000 Inparanoid score I2510
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176152at2759
OrthoFinder 1 1.000 - - FOG0000901
OrthoInspector 1 1.000 - - otm48346
Panther 1 1.100 - - O PTHR12210
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1679
SonicParanoid 1 1.000 - - X485
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.100

Return to query results.
Submit another query.