DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hip14 and AT3G04970

DIOPT Version :9

Sequence 1:NP_001261910.1 Gene:Hip14 / 39747 FlyBaseID:FBgn0259824 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_187148.2 Gene:AT3G04970 / 819657 AraportID:AT3G04970 Length:397 Species:Arabidopsis thaliana


Alignment Length:311 Identity:80/311 - (25%)
Similarity:121/311 - (38%) Gaps:77/311 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   347 MALLPLSVYLATKAWFYVTWLMYIDDAVSFTATVCFLISSLL-LWVCFLKSWKGDPGIIRPTREQ 410
            :|::..:.:|..|:.|......|:.|...:|:.:..::..:| |..||     .|||.:......
plant    85 IAIMGSTYFLTAKSSFIYIPGYYLGDVHKYTSFLAVIVGVILFLLTCF-----SDPGTVNAENVS 144

  Fly   411 RFKTIIELSERGGIGFEPASFCSGCLVRRPIRSKHCSVCDRCVARFDHHCPWVGNCIGLKNHSYF 475
            |:   |.......|.:.... ||.|.:.:|.||||||:|:||||||||||.|:.||||.:|..||
plant   145 RY---ISAYPYDDIIYSKKE-CSTCKIPKPARSKHCSICNRCVARFDHHCGWMNNCIGERNTKYF 205

  Fly   476 MGFLWMLLIMCAWMLYGGSKYYVNQCNVRFDDFLGA----MRAIGNCDAWVG------------- 523
            |.||....::|   |||         .|.....|..    :|.:.....:.|             
plant   206 MAFLLWHFLLC---LYG---------TVAIGFILAGRVKELRVVHILTVYYGVDKSFRSLAPRVI 258

  Fly   524 -WVMGNALLHMSWVILLTICQ-------TYQV-ICLGMTT-------------NERMNRGRYRHF 566
             |::|.....:..::.|.|..       .|.. :||..||             |::::..:....
plant   259 QWLVGTYNTQILLMVFLAIVSLLLAGFFAYHANLCLTNTTTNETFKWREYISLNKKLSEAKASAA 323

  Fly   567 QAKGGHSPFTRGPIQNLVDFLECSCFGL----------VQPKRVDWMNYYD 607
            ..|.|.|...:.|      ..|..||||          |:...:...|.||
plant   324 ALKAGMSCELKKP------SAESKCFGLCGRSSAREEEVKADAIAKRNLYD 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hip14NP_001261910.1 ANK 52..165 CDD:238125
Ank_2 52..142 CDD:289560
ANK repeat 77..108 CDD:293786
ANK repeat 110..142 CDD:293786
ANK 114..233 CDD:238125
Ank_2 116..209 CDD:289560
ANK repeat 144..175 CDD:293786
ANK repeat 177..209 CDD:293786
Ank_5 198..251 CDD:290568
ANK repeat 212..244 CDD:293786
zf-DHHC 426..559 CDD:279823 50/171 (29%)
AT3G04970NP_187148.2 DHHC 90..>218 CDD:388695 49/139 (35%)
DHHC 155..305 CDD:366691 50/162 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D445686at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.